KEGG   Homo sapiens (human): 27341Help
Entry
27341             CDS       T01001                                 

Gene name
RRP7A, BK126B4.3, CGI-96, Rrp7
Definition
(RefSeq) ribosomal RNA processing 7 homolog A
  KO
K14545  ribosomal RNA-processing protein 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    27341 (RRP7A)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   U3 small nucleolar RNA-associated proteins
    27341 (RRP7A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRP7 RRM_1 DUF5093 DUF4591
Motif
Other DBs
NCBI-GeneID: 27341
NCBI-ProteinID: NP_056518
HGNC: 24286
Ensembl: ENSG00000189306
Vega: OTTHUMG00000150891
Pharos: Q9Y3A4(Tdark)
UniProt: Q9Y3A4
Position
22q13.2
AA seq 280 aa AA seqDB search
MVARRRKCAARDPEDRIPSPLGYAAIPIKFSEKQQASHYLYVRAHGVRQGTKSTWPQKRT
LFVLNVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVPGFQVAY
VVFQKPSGVSAALALKGPLLVSTESHPVKSGIHKWISDYADSVPDPEALRVEVDTFMEAY
DQKIAEEEAKAKEEEGVPDEEGWVKVTRRGRRPVLPRTEAASLRVLERERRKRSRKELLN
FYAWQHRESKMEHLAQLRKKFEEDKQRIELLRAQRKFRPY
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggtggcgcgcaggaggaagtgcgccgcgcgggacccggaggaccgtatccccagccca
ctgggctacgcagctattccaatcaagttctctgaaaagcaacaggcttctcactacctc
tatgtgagagcacacggcgttcgacaaggcaccaagtccacctggcctcagaagaggact
ctttttgtcctcaatgtgcccccatactgcacagaggagagcctgtcccgcctcctgtcc
acctgtggcctcgtccagtctgtagagttgcaggagaagccggacctggctgagagccca
aaggagtcaaggtcgaagttttttcatcccaagccagttccgggtttccaggtagcctat
gtggtgttccagaagccaagtggggtgtcagcggccttggccctgaagggccccctgctg
gtgtccacagagagccaccctgtgaagagtggcattcacaagtggatcagtgactacgca
gactctgtgcccgaccctgaggccctgagggtggaagtggacacgttcatggaggcatat
gaccagaagatcgctgaggaagaagctaaggccaaggaggaggagggggtccctgacgag
gagggctgggtgaaggtgacccgccggggccggcggcctgtgctcccccggactgaggca
gccagcttgcgggtgctggagagggagagacggaagcgcagccgaaaagagctgctcaac
ttctacgcctggcagcatcgagagagcaagatggagcatctagcgcagctgcgcaagaag
ttcgaggaggacaagcagaggatcgagctgctgcgggcccagcgcaaattccgaccgtac
tga

DBGET integrated database retrieval system