KEGG   Homo sapiens (human): 27347Help
Entry
27347             CDS       T01001                                 

Gene name
STK39, DCHT, PASK, SPAK
Definition
(RefSeq) serine/threonine kinase 39 (EC:2.7.11.1)
  KO
K08835  
serine/threonine-protein kinase OSR1/STK39 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     27347 (STK39)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   27347 (STK39)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q24.3
AA seq 545 aa AA seqDB search
MAEPSGSPVHVQLPQQAAPVTAAAAAAPAAATAAPAPAAPAAPAPAPAPAAQAVGWPICR
DAYELQEVIGSGATAVVQAALCKPRQERVAIKRINLEKCQTSMDELLKEIQAMSQCSHPN
VVTYYTSFVVKDELWLVMKLLSGGSMLDIIKYIVNRGEHKNGVLEEAIIATILKEVLEGL
DYLHRNGQIHRDLKAGNILLGEDGSVQIADFGVSAFLATGGDVTRNKVRKTFVGTPCWMA
PEVMEQVRGYDFKADMWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPTLETGVEDK
EMMKKYGKSFRKLLSLCLQKDPSKRPTAAELLKCKFFQKAKNREYLIEKLLTRTPDIAQR
AKKVRRVPGSSGHLHKTEDGDWEWSDDEMDEKSEEGKAAFSQEKSRRVKEENPEIAVSAS
TIPEQIQSLSVHDSQGPPNANEDYREASSCAVNLVLRLRNSRKELNDIRFEFTPGRDTAD
GVSQELFSAGLVDGHDVVIVAANLQKIVDDPKALKTLTFKLASGCDGSEIPDEVKLIGFA
QLSVS
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcggagccgagcggctcgcccgtgcacgtccagcttccccagcaggcggccccggtg
acagcggcggcggcggcggccccggcggccgcgacagcagcgccggccccggcagctccc
gcggccccggccccggccccggccccggcggcacaggctgtcggctggcccatctgcagg
gacgcgtacgagctgcaggaggttatcggcagtggagctactgctgtggttcaggcagcc
ctatgcaaacccaggcaagaacgtgtagcaataaaacggatcaacttggaaaaatgccag
accagtatggatgaactattaaaagaaattcaagccatgagtcagtgcagccatcccaac
gtagtgacctattacacctcttttgtggtcaaagatgaactttggctggtcatgaaatta
ctaagtggaggttcaatgttggatatcataaaatacattgtcaaccgaggagaacacaag
aatggagttctggaagaggcaataatagcaacaattcttaaagaggttttggaaggctta
gactatctacacagaaacggtcagattcacagggatttgaaagctggtaatattcttctg
ggtgaggatggttcagtacaaatagcagattttggggtaagtgcgttcctagcaacaggg
ggtgatgttacccgaaataaagtaagaaaaacattcgttggcaccccatgttggatggct
cctgaagtcatggaacaggtgagaggctatgacttcaaggctgacatgtggagttttgga
ataactgccattgaattagcaacaggagcagcgccttatcacaaatatcctcccatgaaa
gtgttaatgttgactttgcaaaatgatccacccactttggaaacaggggtagaggataaa
gaaatgatgaaaaagtacggcaagtcctttagaaaattactttcactgtgtcttcagaaa
gatccttccaaaaggcccacagcagcagaacttttaaaatgcaaattcttccagaaagcc
aagaacagagagtacctgattgagaagctgcttacaagaacaccagacatagcccaaaga
gccaaaaaggtaagaagagttcctgggtcaagtggtcaccttcataaaaccgaagacggg
gactgggagtggagtgacgacgagatggatgagaagagcgaagaagggaaagcagctttt
tctcaggaaaagtcacgaagagtaaaagaagaaaatccagagattgcagtgagtgccagc
accatccccgaacaaatacagtccctctctgtgcacgactctcagggcccacccaatgct
aatgaagactacagagaagcttcttcttgtgccgtgaacctcgttttgagattaagaaac
tccagaaaggaacttaatgacatacgatttgagtttactccaggaagagatacagcagat
ggtgtatctcaggagctcttctctgctggcttggtggatggtcacgatgtagttatagtg
gctgctaatttacagaagattgtagatgatcccaaagctttaaaaacattgacatttaag
ttggcttctggctgtgatgggtcggagattcctgatgaagtgaagctgattgggtttgct
cagttgagtgtcagctga

DBGET integrated database retrieval system