KEGG   Homo sapiens (human): 2739Help
Entry
2739              CDS       T01001                                 

Gene name
GLO1, GLOD1, GLYI, HEL-S-74
Definition
(RefSeq) glyoxalase I
  KO
K01759  
lactoylglutathione lyase [EC:4.4.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    2739 (GLO1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.5  lactoylglutathione lyase
     2739 (GLO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q04760(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.2
AA seq 184 aa AA seqDB search
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQK
CDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNS
DPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKM
ATLM
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaccgcagcccccgtccggcggcctcacggacgaggccgccctcagttgctgc
tccgacgcggaccccagtaccaaggattttctattgcagcagaccatgctacgagtgaag
gatcctaagaagtcactggatttttatactagagttcttggaatgacgctaatccaaaaa
tgtgattttcccattatgaagttttcactctacttcttggcttatgaggataaaaatgac
atccctaaagaaaaagatgaaaaaatagcctgggcgctctccagaaaagctacacttgag
ctgacacacaattggggcactgaagatgatgagacccagagttaccacaatggcaattca
gaccctcgaggattcggtcatattggaattgctgttcctgatgtatacagtgcttgtaaa
aggtttgaagaactgggagtcaaatttgtgaagaaacctgatgatggtaaaatgaaaggc
ctggcatttattcaagatcctgatggctactggattgaaattttgaatcctaacaaaatg
gcaaccttaatgtag

DBGET integrated database retrieval system