KEGG   Homo sapiens (human): 2740Help
Entry
2740              CDS       T01001                                 

Gene name
GLP1R
Definition
(RefSeq) glucagon like peptide 1 receptor
  KO
K04581  
glucagon-like peptide 1 receptor
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Insulin secretion
Drug target
Exenatide: 
Liraglutide: 
Lixisenatide: 
Albiglutide: 
Dulaglutide: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    2740 (GLP1R)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2740 (GLP1R)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    2740 (GLP1R)
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Pancreatic peptide
   Glucagon
    2740 (GLP1R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21
AA seq 463 aa AA seqDB search
MAGAPGPLRLALLLLGMVGRAGPRPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDL
FCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPW
RDLSECEESKRGERSSPEEQLLFLYIIYTVGYALSFSALVIASAILLGFRHLHCTRNYIH
LNLFASFILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLSCRLVFLLMQYCVAAN
YYWLLVEGVYLYTLLAFSVLSEQWIFRLYVSIGWGVPLLFVVPWGIVKYLYEDEGCWTRN
SNMNYWLIIRLPILFAIGVNFLIFVRVICIVVSKLKANLMCKTDIKCRLAKSTLTLIPLL
GTHEVIFAFVMDEHARGTLRFIKLFTELSFTSFQGLMVAILYCFVNNEVQLEFRKSWERW
RLEHLHIQRDSSMKPLKCPTSSLSSGATAGSSMYTATCQASCS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgcccccggcccgctgcgccttgcgctgctgctgctcgggatggtgggcagg
gccggcccccgcccccagggtgccactgtgtccctctgggagacggtgcagaaatggcga
gaataccgacgccagtgccagcgctccctgactgaggatccacctcctgccacagacttg
ttctgcaaccggaccttcgatgaatacgcctgctggccagatggggagccaggctcgttc
gtgaatgtcagctgcccctggtacctgccctgggccagcagtgtgccgcagggccacgtg
taccggttctgcacagctgaaggcctctggctgcagaaggacaactccagcctgccctgg
agggacttgtcggagtgcgaggagtccaagcgaggggaaagaagctccccggaggagcag
ctcctgttcctctacatcatctacacggtgggctacgcactctccttctctgctctggtt
atcgcctctgcgatcctcctcggcttcagacacctgcactgcaccaggaactacatccac
ctgaacctgtttgcatccttcatcctgcgagcattgtccgtcttcatcaaggacgcagcc
ctgaagtggatgtatagcacagccgcccagcagcaccagtgggatgggctcctctcctac
caggactctctgagctgccgcctggtgtttctgctcatgcagtactgtgtggcggccaat
tactactggctcttggtggagggcgtgtacctgtacacactgctggccttctcggtctta
tctgagcaatggatcttcaggctctacgtgagcataggctggggtgttcccctgctgttt
gttgtcccctggggcattgtcaagtacctctatgaggacgagggctgctggaccaggaac
tccaacatgaactactggctcattatccggctgcccattctctttgccattggggtgaac
ttcctcatctttgttcgggtcatctgcatcgtggtatccaaactgaaggccaatctcatg
tgcaagacagacatcaaatgcagacttgccaagtccacgctgacactcatccccctgctg
gggactcatgaggtcatctttgcctttgtgatggacgagcacgcccgggggaccctgcgc
ttcatcaagctgtttacagagctctccttcacctccttccaggggctgatggtggccata
ttatactgctttgtcaacaatgaggtccagctggaatttcggaagagctgggagcgctgg
cggcttgagcacttgcacatccagagggacagcagcatgaagcccctcaagtgtcccacc
agcagcctgagcagtggagccacggcgggcagcagcatgtacacagccacttgccaggcc
tcctgcagctga

DBGET integrated database retrieval system