KEGG   Homo sapiens (human): 27429Help
Entry
27429             CDS       T01001                                 

Gene name
HTRA2, OMI, PARK13, PRSS25
Definition
HtrA serine peptidase 2 (EC:3.4.21.108)
Orthology
K08669  
HtrA serine peptidase 2 [EC:3.4.21.108]
Organism
hsa  Homo sapiens (human)
Pathway
Parkinson's disease
Disease
H00057  
Parkinson's disease (PD)
Class
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p12
AA seq 458 aa AA seqDB search
MAAPRAGRGAGWSLRAWRALGGIRWGRRPRLTPDLRALLTSGTSDPRARVTYGTPSLWAR
LSVGVTEPRACLTSGTPGPRAQLTAVTPDTRTREASENSGTRSRAWLAVALGAGGAVLLL
LWGGGRGPPAVLAAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPIS
NGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPL
PTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAA
IDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRR
YIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQM
VQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgccgagggcggggcggggtgcaggctggagccttcgggcatggcgggctttg
gggggcattcgctgggggaggagaccccgtttgacccctgacctccgggccctgctgacg
tcaggaacttctgacccccgggcccgagtgacttatgggacccccagtctctgggcccgg
ttgtctgttggggtcactgaaccccgagcatgcctgacgtctgggaccccgggtccccgg
gcacaactgactgcggtgaccccagataccaggacccgggaggcctcagagaactctgga
acccgttcgcgcgcgtggctggcggtggcgctgggcgctgggggggcagtgctgttgttg
ttgtggggcgggggtcggggtcctccggccgtcctcgccgccgtccctagcccgccgccc
gcttctccccggagtcagtacaacttcatcgcagatgtggtggagaagacagcacctgcc
gtggtctatatcgagatcctggaccggcaccctttcttgggccgcgaggtccctatctcg
aacggctcaggattcgtggtggctgccgatgggctcattgtcaccaacgcccatgtggtg
gctgatcggcgcagagtccgtgtgagactgctaagcggcgacacgtatgaggccgtggtc
acagctgtggatcccgtggcagacatcgcaacgctgaggattcagactaaggagcctctc
cccacgctgcctctgggacgctcagctgatgtccggcaaggggagtttgttgttgccatg
ggaagtccctttgcactgcagaacacgatcacatccggcattgttagctctgctcagcgt
ccagccagagacctgggactcccccaaaccaatgtggaatacattcaaactgatgcagct
attgattttggaaactctggaggtcccctggttaacctggatggggaggtgattggagtg
aacaccatgaaggtcacagctggaatctcctttgccatcccttctgatcgtcttcgagag
tttctgcatcgtggggaaaagaagaattcctcctccggaatcagtgggtcccagcggcgc
tacattggggtgatgatgctgaccctgagtcccagcatccttgctgaactacagcttcga
gaaccaagctttcccgatgttcagcatggtgtactcatccataaagtcatcctgggctcc
cctgcacaccgggctggtctgcggcctggtgatgtgattttggccattggggagcagatg
gtacaaaatgctgaagatgtttatgaagctgttcgaacccaatcccagttggcagtgcag
atccggcggggacgagaaacactgaccttatatgtgacccctgaggtcacagaatga

DBGET integrated database retrieval system