KEGG   Homo sapiens (human): 2743Help
Entry
2743              CDS       T01001                                 

Gene name
GLRB, HKPX2
Definition
(RefSeq) glycine receptor beta
  KO
K05196  
glycine receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Disease
H00769  
Hyperekplexia
Drug target
Glycine: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2743 (GLRB)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    2743 (GLRB)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  Glycine
   2743 (GLRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q31.3
AA seq 497 aa AA seqDB search
MKFLLTTAFLILISLWVEEAYSKEKSSKKGKGKKKQYLCPSQQSAEDLARVPANSTSNIL
NRLLVSYDPRIRPNFKGIPVDVVVNIFINSFGSIQETTMDYRVNIFLRQKWNDPRLKLPS
DFRGSDALTVDPTMYKCLWKPDLFFANEKSANFHDVTQENILLFIFRDGDVLVSMRLSIT
LSCPLDLTLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQLEKIALPQFDIKKEDIEY
GNCTKYYKGTGYYTCVEVIFTLRRQVGFYMMGVYAPTLLIVVLSWLSFWINPDASAARVP
LGIFSVLSLASECTTLAAELPKVSYVKALDVWLIACLLFGFASLVEYAVVQVMLNNPKRV
EAEKARIAKAEQADGKGGNVAKKNTVNGTGTPVHISTLQVGETRCKKVCTSKSDLRSNDF
SIVGSLPRDFELSNYDCYGKPIEVNNGLGKSQAKNNKKPPPAKPVIPTAAKRIDLYARAL
FPFCFLFFNVIYWSIYL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttttattgacaactgcctttttaattttaatttccttgtgggtggaagaagcc
tattctaaggaaaagtcttcaaagaaagggaaggggaaaaagaagcagtatctatgccca
tctcagcagtcagcagaggaccttgcccgagtacctgccaactccactagcaatatcttg
aacaggttattggtcagttatgatcccaggataagaccaaacttcaaaggcattcctgtt
gatgtagtagtcaacatttttattaacagttttggatccattcaagaaacaacaatggac
tatagagttaacatcttcctgagacaaaaatggaatgaccccaggctgaagctccccagt
gattttaggggttcagatgcactgacagtggatccaacaatgtacaagtgtttatggaaa
cctgatttattttttgcaaatgaaaaaagtgccaattttcatgatgtgacccaggaaaac
atcctcctctttatttttcgtgatggagatgtccttgtcagcatgaggttatctattact
ctttcatgccctttggacttgacattgtttcccatggatacacaacgttgcaagatgcaa
ctggagagctttggttacacaactgatgatttacgatttatctggcagtcaggagatcct
gtgcaattagaaaaaattgccttgcctcaatttgatatcaaaaaggaagatattgaatat
ggtaactgtacaaaatactataaaggcacgggctactacacatgcgtggaagtcatcttc
accctgaggaggcaggtcggcttttacatgatgggggtctacgccccaaccctgctcatt
gttgttctctcctggctttccttctggatcaacccggacgcgagtgctgccagagtgccc
ctgggtatcttctcagtcctcagcttggcctctgagtgcacaacccttgccgctgagctt
cccaaagtttcctatgtgaaggctcttgatgtttggcttattgcttgccttctctttggg
tttgcttccctggtggagtatgcagttgtccaggtgatgctgaacaaccccaaaagggtt
gaagctgaaaaagccagaattgctaaggctgagcaagcagatggaaaaggtggaaatgtg
gctaaaaagaatactgtgaatggaacagggactcctgttcatattagcactttgcaggtt
ggtgagaccagatgcaaaaaagtttgtacttctaagtctgatctgagatctaatgacttc
agcattgttggaagcttaccaagagattttgaactatccaattatgactgctatggaaaa
cccattgaagttaacaacggacttgggaaatctcaggctaagaacaacaagaagcctccc
cctgcgaaacctgttattccaacagcagcaaagcgaattgatctttatgcaagagcattg
tttcctttctgcttcttgttcttcaatgttatatattggtctatatatttatga

DBGET integrated database retrieval system