KEGG   Homo sapiens (human): 27430Help
Entry
27430             CDS       T01001                                 

Gene name
MAT2B, MAT-II, MATIIbeta, Nbla02999, SDR23E1, TGR
Definition
(RefSeq) methionine adenosyltransferase 2B
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00270  Cysteine and methionine metabolism
hsa01100  Metabolic pathways
hsa01230  Biosynthesis of amino acids
Module
hsa_M00034  Methionine salvage pathway
hsa_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    27430 (MAT2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     27430 (MAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RmlD_sub_bind Epimerase GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_4 3Beta_HSD DapB_N
Motif
Other DBs
NCBI-GeneID: 27430
NCBI-ProteinID: NP_037415
OMIM: 605527
HGNC: 6905
Ensembl: ENSG00000038274
Vega: OTTHUMG00000130379
Pharos: Q9NZL9(Tbio)
UniProt: Q9NZL9 A0A140VJP2
Structure
PDB: 

Jmol
Position
5q34
AA seq 334 aa AA seqDB search
MVGREKELSIHFVPGSCRLVEEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGF
RRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNL
AKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVL
RIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRML
DPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNAQLDCSKL
ETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggtggggcgggagaaagagctctctatacactttgttcccgggagctgtcggctggtg
gaggaggaagttaacatccctaataggagggttctggttactggtgccactgggcttctt
ggcagagctgtacacaaagaatttcagcagaataattggcatgcagttggctgtggtttc
agaagagcaagaccaaaatttgaacaggttaatctgttggattctaatgcagttcatcac
atcattcatgattttcagccccatgttatagtacattgtgcagcagagagaagaccagat
gttgtagaaaatcagccagatgctgcctctcaacttaatgtggatgcttctgggaattta
gcaaaggaagcagctgctgttggagcatttctcatctacattagctcagattatgtattt
gatggaacaaatccaccttacagagaggaagacataccagctcccctaaatttgtatggc
aaaacaaaattagatggagaaaaggctgtcctggagaacaatctaggagctgctgttttg
aggattcctattctgtatggggaagttgaaaagctcgaagaaagtgctgtgactgttatg
tttgataaagtgcagttcagcaacaagtcagcaaacatggatcactggcagcagaggttc
cccacacatgtcaaagatgtggccactgtgtgccggcagctagcagagaagagaatgctg
gatccatcaattaagggaacctttcactggtctggcaatgaacagatgactaagtatgaa
atggcatgtgcaattgcagatgccttcaacctccccagcagtcacttaagacctattact
gacagccctgtcctaggagcacaacgtccgagaaatgctcagcttgactgctccaaattg
gagaccttgggcattggccaacgaacaccatttcgaattggaatcaaagaatcactttgg
cctttcctcattgacaagagatggagacaaacggtctttcattag

DBGET integrated database retrieval system