KEGG   Homo sapiens (human): 2744Help
Entry
2744              CDS       T01001                                 

Gene name
GLS, AAD20, GAC, GAM, GLS1, KGA
Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    2744 (GLS)
   00330 Arginine and proline metabolism
    2744 (GLS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    2744 (GLS)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    2744 (GLS)
  Nervous system
   04724 Glutamatergic synapse
    2744 (GLS)
   04727 GABAergic synapse
    2744 (GLS)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    2744 (GLS)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     2744 (GLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q32-q34
AA seq 598 aa AA seqDB search
MMRLRGSGMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRGGGRPAAGPAAAARLHPWWGG
GGWPAEPLARGLSSSPSEILQELGKGSTHPQPGVSPPAAPAAPGPKDGPGETDAFGNSEG
KELVASGENKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMD
MLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYESAKK
QSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKVPFCLQSCVKPLKYAIAVNDL
GTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQ
FLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSI
EVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPA
KSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKL
DPRREGGDQRHSFGPLDYESLQQELALKETVWKKVSPESNEDISTTVVYRMESLGEKS
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggctgcgaggctcggggatgctgcgggacctgctcctgcggtcgcccgccggc
gtgagcgcgactctgcggcgggcacagcccttggtcaccctgtgccggcgtccccgaggc
gggggacggccggccgcgggcccggctgccgccgcgcgactccacccgtggtggggcggg
ggcggctggccggcggagcccctcgcgcggggcctgtccagctctccttcggagatcttg
caggagctgggcaaggggagcacgcatccgcagcccggggtgtcgccacccgctgccccg
gcggcgcccggccccaaggacggccccggggagacggacgcgtttggcaacagcgagggc
aaagagctggtggcctcaggtgaaaataaaataaaacagggtctgttacctagcttggaa
gatttgctgttctatacaattgctgaaggacaagagaaaatacctgttcataaatttatt
acagcactcaaatctacaggattgcgaacgtctgatcccaggttgaaagagtgtatggat
atgttaagattaactcttcaaacaacatcagatggtgtcatgctagacaaagatcttttt
aaaaaatgtgttcagagcaacattgttttgttgacacaagcatttagaagaaagtttgtg
attcctgactttatgtcttttacctcacacattgatgagttatatgaaagtgctaaaaag
cagtctggaggaaaggttgcagattatattcctcaactggccaaattcagtcccgatttg
tggggtgtgtctgtttgtacagtagatggacagaggcattctactggagataccaaagtt
cccttctgtcttcagtcctgtgtaaaacctttgaaatatgccattgctgttaatgatctt
ggaactgaatatgtgcatcgatatgttggaaaagagccgagtggactaagattcaacaaa
ctatttttgaatgaagatgataaaccacataatcctatggtaaatgctggagcaattgtt
gtgacttcactaataaagcaaggagtaaataatgctgaaaaatttgactatgtcatgcag
tttttgaataagatggctggtaatgaatatgttggattcagtaatgcaacgtttcagtct
gaaagagaaagtggagatcgaaattttgcaataggatattacttaaaagaaaagaagtgt
tttccagaaggcacagacatggttggtatattagacttctacttccagctgtgctccatt
gaagtgacttgtgaatcagccagtgtgatggctgcgacactggctaatggtggtttctgc
ccaattactggtgaaagagtactgagccctgaagcagttcgaaatacattgagtttgatg
cattcctgtggcatgtatgacttctcagggcagtttgctttccatgttggtcttcctgca
aaatctggagttgctgggggcattcttttagttgtccccaatgttatgggtatgatgtgc
tggtctcctcctctggataagatgggcaacagtgttaagggaattcacttttgtcacgat
cttgtttctctgtgtaatttccataactatgataatttgagacactttgcaaaaaaactt
gatcctcgaagagaaggtggtgatcaaaggcattcctttggaccattggactatgaaagt
ctccaacaagaacttgctttaaaagagacagtatggaaaaaagtgtcacctgagtcaaat
gaggacatctctacaactgtagtatatagaatggaaagtctgggagagaaaagctaa

DBGET integrated database retrieval system