KEGG   Homo sapiens (human): 2746Help
Entry
2746              CDS       T01001                                 

Gene name
GLUD1, GDH, GDH1, GLUD
Definition
(RefSeq) glutamate dehydrogenase 1 (EC:1.4.1.3)
  KO
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Carbon metabolism
Proximal tubule bicarbonate reclamation
Disease
H01267  
Familial hyperinsulinemic hypoglycemia (HHF)
H01400  
Secondary hyperammonemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    2746 (GLUD1)
  Energy metabolism
   00910 Nitrogen metabolism
    2746 (GLUD1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    2746 (GLUD1)
   00220 Arginine biosynthesis
    2746 (GLUD1)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    2746 (GLUD1)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    2746 (GLUD1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     2746 (GLUD1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   2746 (GLUD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q23.3
AA seq 558 aa AA seqDB search
MYRYLGEALLLSRAGPAALGSASADSAALLGWARGQPAAAPQPGLALAARRHYSEAVADR
EDDPNFFKMVEGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF
PIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFG
GAKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGEREMSWIADTY
ASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFG
DKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILG
FPKAKPYEGSILEADCDILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLER
NIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGK
HGGTIPIVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYV
NAIEKVFKVYNEAGVTFT
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgctacctgggcgaagcgctgttgctgtcccgggccgggcccgctgccctgggc
tcggcgtccgccgactcggccgcgttgctgggctgggcccggggacagcccgccgccgcc
ccgcagccggggctggcattggccgcccggcgccactacagcgaggcggtggccgaccgc
gaggacgaccccaacttcttcaagatggtggagggcttcttcgatcgcggcgccagcatc
gtggaggacaagctggtggaggacctgaggacccgggagagcgaggagcagaagcggaac
cgggtgcgcggcatcctgcggatcatcaagccctgcaaccatgtgctgagtctctccttc
cccatccggcgcgacgacggctcctgggaggtcatcgaaggctaccgggcccagcacagc
cagcaccgcacgccctgcaagggaggtatccgttacagcactgatgtgagtgtagatgaa
gtaaaagctttggcttctctgatgacatacaagtgtgcagtggttgatgtgccgtttggg
ggtgctaaagctggtgttaagatcaatcccaagaactatactgataatgaattggaaaag
atcacaaggaggttcaccatggagctagcaaaaaagggctttattggtcctggcattgat
gtgcctgctccagacatgagcacaggtgagcgggagatgtcctggatcgctgatacctat
gccagcaccatagggcactatgatattaatgcacacgcctgtgttactggtaaacccatc
agccaagggggaatccatggacgcatctctgctactggccgtggtgtcttccatgggatt
gaaaatttcatcaatgaagcttcttacatgagcattttaggaatgacaccagggtttgga
gataaaacatttgttgttcagggatttggtaatgtgggcctacactctatgagatattta
catcgttttggtgctaaatgtattgctgttggtgagtctgatgggagtatatggaatcca
gatggtattgacccaaaggaactggaagacttcaaattgcaacatgggtccattctgggc
ttccccaaggcaaagccctatgaaggaagcatcttggaggccgactgtgacatactgatc
ccagctgccagtgagaagcagttgaccaaatccaacgcacccagagtcaaagccaagatc
attgctgaaggtgccaatgggccaacaactccagaagctgacaagatcttcctggagaga
aacattatggttattccagatctctacttgaatgctggaggagtgacagtatcttacttt
gagtggctgaagaatctaaatcatgtcagctatggccgtttgaccttcaaatatgaaagg
gattctaactaccacttgctcatgtctgttcaagagagtttagaaagaaaatttggaaag
catggtggaactattcccattgtacccacggcagagttccaagacaggatatcgggtgca
tctgagaaagacatcgtgcactctggcttggcatacacaatggagcgttctgccaggcaa
attatgcgcacagccatgaagtataacctgggattggacctgagaacagctgcctatgtt
aatgccattgagaaagtcttcaaagtgtacaatgaagctggtgtgaccttcacatag

DBGET integrated database retrieval system