KEGG   Homo sapiens (human): 2767Help
Entry
2767              CDS       T01001                                 

Gene name
GNA11, FBH, FBH2, FHH2, GNA-11, HHC2, HYPOC2
Definition
guanine nucleotide binding protein (G protein), alpha 11 (Gq class)
Orthology
K04635  
guanine nucleotide-binding protein subunit alpha-11
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Gap junction
Cholinergic synapse
Long-term depression
Insulin secretion
GnRH signaling pathway
Chagas disease (American trypanosomiasis)
Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    2767 (GNA11)
   04022 cGMP - PKG signaling pathway
    2767 (GNA11)
 Cellular Processes
  Cell communication
   04540 Gap junction
    2767 (GNA11)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    2767 (GNA11)
   04912 GnRH signaling pathway
    2767 (GNA11)
  Circulatory system
   04270 Vascular smooth muscle contraction
    2767 (GNA11)
  Nervous system
   04725 Cholinergic synapse
    2767 (GNA11)
   04730 Long-term depression
    2767 (GNA11)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    2767 (GNA11)
   05142 Chagas disease (American trypanosomiasis)
    2767 (GNA11)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2767 (GNA11)
  Exosomal proteins of melanoma cells
   2767 (GNA11)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    2767 (GNA11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
19p13.3
AA seq 359 aa AA seqDB search
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGAGYSEEDKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEK
VTTFEHQYVSAIKTLWEDPGIQECYDRRREYQLSDSAKYYLTDVDRIATLGYLPTQQDVL
RVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILYSHLVDYFPEFDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgactctggagtccatgatggcgtgttgcctgagcgatgaggtgaaggagtccaagcgg
atcaacgccgagatcgagaagcagctgcggcgggacaagcgcgacgcccggcgcgagctc
aagctgctgctgctcggcacgggcgagagcgggaagagcacgttcatcaagcagatgcgc
atcatccacggcgccggctactcggaggaggacaagcgcggcttcaccaagctcgtctac
cagaacatcttcaccgccatgcaggccatgatccgggccatggagacgctcaagatcctc
tacaagtacgagcagaacaaggccaatgcgctcctgatccgggaggtggacgtggagaag
gtgaccaccttcgagcatcagtacgtcagtgccatcaagaccctgtgggaggacccgggc
atccaggaatgctacgaccgcaggcgcgagtaccagctctccgactctgccaagtactac
ctgaccgacgttgaccgcatcgccaccttgggctacctgcccacccagcaggacgtgctg
cgggtccgcgtgcccaccaccggcatcatcgagtaccctttcgacctggagaacatcatc
ttccggatggtggatgtggggggccagcggtcggagcggaggaagtggatccactgcttt
gagaacgtgacatccatcatgtttctcgtcgccctcagcgaatacgaccaagtcctggtg
gagtcggacaacgagaaccggatggaggagagcaaagccctgttccggaccatcatcacc
tacccctggttccagaactcctccgtcatcctcttcctcaacaagaaggacctgctggag
gacaagatcctgtactcgcacctggtggactacttccccgagttcgatggtccccagcgg
gacgcccaggcggcgcgggagttcatcctgaagatgttcgtggacctgaaccccgacagc
gacaagatcatctactcacacttcacgtgtgccaccgacacggagaacatccgcttcgtg
ttcgcggccgtgaaggacaccatcctgcagctcaacctcaaggagtacaacctggtctga

  All links  
No link information was found.   
DBGET integrated database retrieval system