KEGG   Homo sapiens (human): 2767Help
Entry
2767              CDS       T01001                                 

Gene name
GNA11, GNA-11, HHC2, HYPOC2
Definition
guanine nucleotide binding protein (G protein), alpha 11 (Gq class)
Orthology
K04635  
guanine nucleotide-binding protein subunit alpha-11
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Vascular smooth muscle contraction
Gap junction
Cholinergic synapse
Long-term depression
Insulin secretion
GnRH signaling pathway
Chagas disease (American trypanosomiasis)
Amoebiasis
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Cellular Processes; Cell communication; Gap junction [PATH:hsa04540]
Organismal Systems; Endocrine system; Insulin secretion [PATH:hsa04911]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:hsa04912]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:hsa04725]
Organismal Systems; Nervous system; Long-term depression [PATH:hsa04730]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
19p13.3
AA seq 359 aa AA seqDB search
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGAGYSEEDKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEK
VTTFEHQYVSAIKTLWEDPGIQECYDRRREYQLSDSAKYYLTDVDRIATLGYLPTQQDVL
RVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILYSHLVDYFPEFDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgactctggagtccatgatggcgtgttgcctgagcgatgaggtgaaggagtccaagcgg
atcaacgccgagatcgagaagcagctgcggcgggacaagcgcgacgcccggcgcgagctc
aagctgctgctgctcggcacgggcgagagcgggaagagcacgttcatcaagcagatgcgc
atcatccacggcgccggctactcggaggaggacaagcgcggcttcaccaagctcgtctac
cagaacatcttcaccgccatgcaggccatgatccgggccatggagacgctcaagatcctc
tacaagtacgagcagaacaaggccaatgcgctcctgatccgggaggtggacgtggagaag
gtgaccaccttcgagcatcagtacgtcagtgccatcaagaccctgtgggaggacccgggc
atccaggaatgctacgaccgcaggcgcgagtaccagctctccgactctgccaagtactac
ctgaccgacgttgaccgcatcgccaccttgggctacctgcccacccagcaggacgtgctg
cgggtccgcgtgcccaccaccggcatcatcgagtaccctttcgacctggagaacatcatc
ttccggatggtggatgtggggggccagcggtcggagcggaggaagtggatccactgcttt
gagaacgtgacatccatcatgtttctcgtcgccctcagcgaatacgaccaagtcctggtg
gagtcggacaacgagaaccggatggaggagagcaaagccctgttccggaccatcatcacc
tacccctggttccagaactcctccgtcatcctcttcctcaacaagaaggacctgctggag
gacaagatcctgtactcgcacctggtggactacttccccgagttcgatggtccccagcgg
gacgcccaggcggcgcgggagttcatcctgaagatgttcgtggacctgaaccccgacagc
gacaagatcatctactcacacttcacgtgtgccaccgacacggagaacatccgcttcgtg
ttcgcggccgtgaaggacaccatcctgcagctcaacctcaaggagtacaacctggtctga

DBGET integrated database retrieval system