KEGG   Homo sapiens (human): 2768Help
Entry
2768              CDS       T01001                                 

Gene name
GNA12, NNX3, RMP, gep
Definition
guanine nucleotide binding protein (G protein) alpha 12
Orthology
K04346  
guanine nucleotide-binding protein subunit alpha-12
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Long-term depression
Regulation of actin cytoskeleton
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    2768 (GNA12)
   04022 cGMP - PKG signaling pathway
    2768 (GNA12)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2768 (GNA12)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    2768 (GNA12)
  Nervous system
   04730 Long-term depression
    2768 (GNA12)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2768 (GNA12)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   2768 (GNA12)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    2768 (GNA12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p22.2
AA seq 305 aa AA seqDB search
MAPRAGLGAGPLLLRSRADWVCGGWEAALSAPPPFCTAWVERTGLVHFLREGGHGACFPL
ALLHPGSVVSFQMIYPLIVLPLCASWHWGLIRKGIVLFWGESVKYFLDNLDRIGQLNYFP
SKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQCFDGITSILFMVSSSE
YDQVLMEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKMDLLVEKVKTVSIKKHFPD
FRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENVRFVFHAVKDTILQENLK
DIMLQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggctccacgagcagggctcggagctggccctctcctgcttcggagccgcgctgactgg
gtgtgtggcggatgggaggccgccctgagtgctcctcctcccttttgtacagcctgggtg
gaaaggacgggcctggtgcacttcctgcgggagggaggacatggggcctgcttccctctg
gcgctcctccacccgggcagcgtggtttctttccaaatgatttatcctctcatcgtcctg
ccgctctgtgcttcatggcattggggtcttatccggaaggggattgtccttttttggggg
gagtcggtgaagtacttcctggacaacttggaccggatcggccagctgaattactttcct
agtaagcaagatatcctgctggctaggaaagccaccaagggaattgtggagcatgacttc
gttattaagaagatcccctttaagatggtggatgtgggcggccagcggtcccagcgccag
aagtggttccagtgcttcgacgggatcacgtccatcctgttcatggtctcctccagcgag
tacgaccaggtcctcatggaggacaggcgcaccaaccggctggtggagtccatgaacatc
ttcgagaccatcgtcaacaacaagctcttcttcaacgtctccatcattctcttcctcaac
aagatggacctcctggtggagaaggtgaagaccgtgagcatcaagaagcacttcccggac
ttcaggggcgacccgcacaggctggaggacgtccagcgctacctggtccagtgcttcgac
aggaagagacggaaccgcagcaagccactcttccaccacttcaccaccgccatcgacacc
gagaacgtccgcttcgtgttccatgctgtgaaagacaccatcctgcaggagaacctgaag
gacatcatgctgcagtga

DBGET integrated database retrieval system