KEGG   Homo sapiens (human): 2769Help
Entry
2769              CDS       T01001                                 

Gene name
GNA15, GNA16
Definition
guanine nucleotide binding protein (G protein), alpha 15 (Gq class)
Orthology
K04637  
guanine nucleotide-binding protein subunit alpha-15
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Chagas disease (American trypanosomiasis)
Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    2769 (GNA15)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    2769 (GNA15)
   05142 Chagas disease (American trypanosomiasis)
    2769 (GNA15)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    2769 (GNA15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 374 aa AA seqDB search
MARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPGESGKSTFIK
QMRIIHGAGYSEEERKGFRPLVYQNIFVSMRAMIEAMERLQIPFSRPESKHHASLVMSQD
PYKVTTFEKRYAAAMQWLWRDAGIRACYERRREFHLLDSAVYYLSHLERITEEGYVPTAQ
DVLRSRMPTTGINEYCFSVQKTNLRIVDVGGQKSERKKWIHCFENVIALIYLASLSEYDQ
CLEENNQENRMKESLALFGTILELPWFKSTSVILFLNKTDILEEKIPTSHLATYFPSFQG
PKQDAEAAKRFILDMYTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQNIRKVFKDVR
DSVLARYLDEINLL
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggcccgctcgctgacctggcgctgctgcccctggtgcctgacggaggatgagaaggcc
gccgcccgggtggaccaggagatcaacaggatcctcttggagcagaagaagcaggaccgc
ggggagctgaagctgctgcttttgggcccaggcgagagcgggaagagcaccttcatcaag
cagatgcggatcatccacggcgccggctactcggaggaggagcgcaagggcttccggccc
ctggtctaccagaacatcttcgtgtccatgcgggccatgatcgaggccatggagcggctg
cagattccattcagcaggcccgagagcaagcaccacgctagcctggtcatgagccaggac
ccctataaagtgaccacgtttgagaagcgctacgctgcggccatgcagtggctgtggagg
gatgccggcatccgggcctgctatgagcgtcggcgggaattccacctgctcgattcagcc
gtgtactacctgtcccacctggagcgcatcaccgaggagggctacgtccccacagctcag
gacgtgctccgcagccgcatgcccaccactggcatcaacgagtactgcttctccgtgcag
aaaaccaacctgcggatcgtggacgtcgggggccagaagtcagagcgtaagaaatggatc
cattgtttcgagaacgtgatcgccctcatctacctggcctcactgagtgaatacgaccag
tgcctggaggagaacaaccaggagaaccgcatgaaggagagcctcgcattgtttgggact
atcctggaactaccctggttcaaaagcacatccgtcatcctctttctcaacaaaaccgac
atcctggaggagaaaatccccacctcccacctggctacctatttccccagtttccagggc
cctaagcaggatgctgaggcagccaagaggttcatcctggacatgtacacgaggatgtac
accgggtgcgtggacggccccgagggcagcaagaagggcgcacgatcccgacgcctcttc
agccactacacatgtgccacagacacacagaacatccgcaaggtcttcaaggacgtgcgg
gactcggtgctcgcccgctacctggacgagatcaacctgctgtga

DBGET integrated database retrieval system