KEGG   Homo sapiens (human): 2769Help
Entry
2769              CDS       T01001                                 

Gene name
GNA15, GNA16
Definition
(RefSeq) G protein subunit alpha 15
  KO
K04637  
guanine nucleotide-binding protein subunit alpha-15
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Relaxin signaling pathway
Chagas disease (American trypanosomiasis)
Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    2769 (GNA15)
 Organismal Systems
  Endocrine system
   04926 Relaxin signaling pathway
    2769 (GNA15)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    2769 (GNA15)
   05142 Chagas disease (American trypanosomiasis)
    2769 (GNA15)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    2769 (GNA15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P30679(Tbio)
UniProt: 
Position
19p13.3
AA seq 374 aa AA seqDB search
MARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPGESGKSTFIK
QMRIIHGAGYSEEERKGFRPLVYQNIFVSMRAMIEAMERLQIPFSRPESKHHASLVMSQD
PYKVTTFEKRYAAAMQWLWRDAGIRACYERRREFHLLDSAVYYLSHLERITEEGYVPTAQ
DVLRSRMPTTGINEYCFSVQKTNLRIVDVGGQKSERKKWIHCFENVIALIYLASLSEYDQ
CLEENNQENRMKESLALFGTILELPWFKSTSVILFLNKTDILEEKIPTSHLATYFPSFQG
PKQDAEAAKRFILDMYTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQNIRKVFKDVR
DSVLARYLDEINLL
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggcccgctcgctgacctggcgctgctgcccctggtgcctgacggaggatgagaaggcc
gccgcccgggtggaccaggagatcaacaggatcctcttggagcagaagaagcaggaccgc
ggggagctgaagctgctgcttttgggcccaggcgagagcgggaagagcaccttcatcaag
cagatgcggatcatccacggcgccggctactcggaggaggagcgcaagggcttccggccc
ctggtctaccagaacatcttcgtgtccatgcgggccatgatcgaggccatggagcggctg
cagattccattcagcaggcccgagagcaagcaccacgctagcctggtcatgagccaggac
ccctataaagtgaccacgtttgagaagcgctacgctgcggccatgcagtggctgtggagg
gatgccggcatccgggcctgctatgagcgtcggcgggaattccacctgctcgattcagcc
gtgtactacctgtcccacctggagcgcatcaccgaggagggctacgtccccacagctcag
gacgtgctccgcagccgcatgcccaccactggcatcaacgagtactgcttctccgtgcag
aaaaccaacctgcggatcgtggacgtcgggggccagaagtcagagcgtaagaaatggatc
cattgtttcgagaacgtgatcgccctcatctacctggcctcactgagtgaatacgaccag
tgcctggaggagaacaaccaggagaaccgcatgaaggagagcctcgcattgtttgggact
atcctggaactaccctggttcaaaagcacatccgtcatcctctttctcaacaaaaccgac
atcctggaggagaaaatccccacctcccacctggctacctatttccccagtttccagggc
cctaagcaggatgctgaggcagccaagaggttcatcctggacatgtacacgaggatgtac
accgggtgcgtggacggccccgagggcagcaagaagggcgcacgatcccgacgcctcttc
agccactacacatgtgccacagacacacagaacatccgcaaggtcttcaaggacgtgcgg
gactcggtgctcgcccgctacctggacgagatcaacctgctgtga

DBGET integrated database retrieval system