KEGG   Homo sapiens (human): 2771Help
Entry
2771              CDS       T01001                                 

Gene name
GNAI2, GIP, GNAI2B, H_LUCA15.1, H_LUCA16.1
Definition
guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2
Orthology
K04630  
guanine nucleotide-binding protein G(i) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Adrenergic signaling in cardiomyocytes
Axon guidance
Tight junction
Gap junction
Platelet activation
Leukocyte transendothelial migration
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Long-term depression
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Oxytocin signaling pathway
Gastric acid secretion
Parkinson's disease
Cocaine addiction
Morphine addiction
Alcoholism
Pertussis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Pathways in cancer
Disease
H00033  
Adrenal carcinoma
H01019  
Catecholaminergic polymorphic ventricular tachycardia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    2771 (GNAI2)
   04024 cAMP signaling pathway
    2771 (GNAI2)
   04022 cGMP - PKG signaling pathway
    2771 (GNAI2)
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    2771 (GNAI2)
   04540 Gap junction
    2771 (GNAI2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    2771 (GNAI2)
   04670 Leukocyte transendothelial migration
    2771 (GNAI2)
   04062 Chemokine signaling pathway
    2771 (GNAI2)
  Endocrine system
   04915 Estrogen signaling pathway
    2771 (GNAI2)
   04914 Progesterone-mediated oocyte maturation
    2771 (GNAI2)
   04921 Oxytocin signaling pathway
    2771 (GNAI2)
   04916 Melanogenesis
    2771 (GNAI2)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    2771 (GNAI2)
  Digestive system
   04971 Gastric acid secretion
    2771 (GNAI2)
  Nervous system
   04724 Glutamatergic synapse
    2771 (GNAI2)
   04727 GABAergic synapse
    2771 (GNAI2)
   04725 Cholinergic synapse
    2771 (GNAI2)
   04728 Dopaminergic synapse
    2771 (GNAI2)
   04726 Serotonergic synapse
    2771 (GNAI2)
   04730 Long-term depression
    2771 (GNAI2)
   04723 Retrograde endocannabinoid signaling
    2771 (GNAI2)
  Development
   04360 Axon guidance
    2771 (GNAI2)
  Environmental adaptation
   04713 Circadian entrainment
    2771 (GNAI2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2771 (GNAI2)
  Neurodegenerative diseases
   05012 Parkinson's disease
    2771 (GNAI2)
  Substance dependence
   05030 Cocaine addiction
    2771 (GNAI2)
   05032 Morphine addiction
    2771 (GNAI2)
   05034 Alcoholism
    2771 (GNAI2)
  Infectious diseases
   05133 Pertussis
    2771 (GNAI2)
   05145 Toxoplasmosis
    2771 (GNAI2)
   05142 Chagas disease (American trypanosomiasis)
    2771 (GNAI2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   2771 (GNAI2)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    2771 (GNAI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.31
AA seq 318 aa AA seqDB search
MRGAGESGKSTIVKQMKIIHEDGYSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFAD
PSRADDARQLFALSCTAEEQGVLPDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYL
NDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFE
GVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEE
KITHSPLTICFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVF
DAVTDVIIKNNLKDCGLF
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagaggtgctggggagtcagggaagagcaccatcgtcaagcagatgaagatcatccac
gaggatggctactccgaggaggaatgccggcagtaccgggcggttgtctacagcaacacc
atccagtccatcatggccattgtcaaagccatgggcaacctgcagatcgactttgccgac
ccctccagagcggacgacgccaggcagctatttgcactgtcctgcaccgccgaggagcaa
ggcgtgctccctgatgacctgtccggcgtcatccggaggctctgggctgaccatggtgtg
caggcctgctttggccgctcaagggaataccagctcaacgactcagctgcctactacctg
aacgacctggagcgtattgcacagagtgactacatccccacacagcaagatgtgctacgg
acccgcgtaaagaccacggggatcgtggagacacacttcaccttcaaggacctacacttc
aagatgtttgatgtgggtggtcagcggtctgagcggaagaagtggatccactgctttgag
ggcgtcacagccatcatcttctgcgtagccttgagcgcctatgacttggtgctagctgag
gacgaggagatgaaccgcatgcatgagagcatgaagctattcgatagcatctgcaacaac
aagtggttcacagacacgtccatcatcctcttcctcaacaagaaggacctgtttgaggag
aagatcacacacagtcccctgaccatctgcttccctgagtacacaggggccaacaaatat
gatgaggcagccagctacatccagagtaagtttgaggacctgaataagcgcaaagacacc
aaggagatctacacgcacttcacgtgcgccaccgacaccaagaacgtgcagttcgtgttt
gacgccgtcaccgatgtcatcatcaagaacaacctgaaggactgcggcctcttctga

DBGET integrated database retrieval system