KEGG   Homo sapiens (human): 2771Help
Entry
2771              CDS       T01001                                 

Gene name
GNAI2, GIP, GNAI2B, H_LUCA15.1, H_LUCA16.1
Definition
guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2
Orthology
K04630  
guanine nucleotide-binding protein G(i) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Chemokine signaling pathway
Adrenergic signaling in cardiomyocytes
Axon guidance
Tight junction
Gap junction
Leukocyte transendothelial migration
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Long-term depression
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Oxytocin signaling pathway
Gastric acid secretion
Parkinson's disease
Cocaine addiction
Morphine addiction
Alcoholism
Pertussis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Disease
H00033  
Adrenal carcinoma
H01019  
Catecholaminergic polymorphic ventricular tachycardia
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
Cellular Processes; Cell communication; Gap junction [PATH:hsa04540]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:hsa04915]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:hsa04914]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
Organismal Systems; Endocrine system; Melanogenesis [PATH:hsa04916]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:hsa04261]
Organismal Systems; Digestive system; Gastric acid secretion [PATH:hsa04971]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:hsa04724]
Organismal Systems; Nervous system; GABAergic synapse [PATH:hsa04727]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:hsa04725]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
Organismal Systems; Nervous system; Long-term depression [PATH:hsa04730]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:hsa04723]
Organismal Systems; Development; Axon guidance [PATH:hsa04360]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:hsa04713]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
Human Diseases; Substance dependence; Cocaine addiction [PATH:hsa05030]
Human Diseases; Substance dependence; Morphine addiction [PATH:hsa05032]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.31
AA seq 318 aa AA seqDB search
MRGAGESGKSTIVKQMKIIHEDGYSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFAD
PSRADDARQLFALSCTAEEQGVLPDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYL
NDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFE
GVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEE
KITHSPLTICFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVF
DAVTDVIIKNNLKDCGLF
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagaggtgctggggagtcagggaagagcaccatcgtcaagcagatgaagatcatccac
gaggatggctactccgaggaggaatgccggcagtaccgggcggttgtctacagcaacacc
atccagtccatcatggccattgtcaaagccatgggcaacctgcagatcgactttgccgac
ccctccagagcggacgacgccaggcagctatttgcactgtcctgcaccgccgaggagcaa
ggcgtgctccctgatgacctgtccggcgtcatccggaggctctgggctgaccatggtgtg
caggcctgctttggccgctcaagggaataccagctcaacgactcagctgcctactacctg
aacgacctggagcgtattgcacagagtgactacatccccacacagcaagatgtgctacgg
acccgcgtaaagaccacggggatcgtggagacacacttcaccttcaaggacctacacttc
aagatgtttgatgtgggtggtcagcggtctgagcggaagaagtggatccactgctttgag
ggcgtcacagccatcatcttctgcgtagccttgagcgcctatgacttggtgctagctgag
gacgaggagatgaaccgcatgcatgagagcatgaagctattcgatagcatctgcaacaac
aagtggttcacagacacgtccatcatcctcttcctcaacaagaaggacctgtttgaggag
aagatcacacacagtcccctgaccatctgcttccctgagtacacaggggccaacaaatat
gatgaggcagccagctacatccagagtaagtttgaggacctgaataagcgcaaagacacc
aaggagatctacacgcacttcacgtgcgccaccgacaccaagaacgtgcagttcgtgttt
gacgccgtcaccgatgtcatcatcaagaacaacctgaaggactgcggcctcttctga

DBGET integrated database retrieval system