KEGG   Homo sapiens (human): 2774Help
Entry
2774              CDS       T01001                                 

Gene name
GNAL, DYT25
Definition
guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type
Orthology
K04633  
guanine nucleotide-binding protein G(olf) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Dopaminergic synapse
Olfactory transduction
Parkinson's disease
Chagas disease (American trypanosomiasis)
Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    2774 (GNAL)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    2774 (GNAL)
  Sensory system
   04740 Olfactory transduction
    2774 (GNAL)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    2774 (GNAL)
  Infectious diseases
   05146 Amoebiasis
    2774 (GNAL)
   05142 Chagas disease (American trypanosomiasis)
    2774 (GNAL)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    2774 (GNAL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18p11.22-p11.21
AA seq 381 aa AA seqDB search
MGCLGGNSKTTEDQGVDEKERREANKKIEKQLQKERLAYKATHRLLLLGAGESGKSTIVK
QMRILHVNGFNPEEKKQKILDIRKNVKDAIVTIVSAMSTIIPPVPLANPENQFRSDYIKS
IAPITDFEYSQEFFDHVKKLWDDEGVKACFERSNEYQLIDCAQYFLERIDSVSLVDYTPT
DQDLLRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIYVAACSSY
NMVIREDNNTNRLRESLDLFESIWNNRWLRTISIILFLNKQDMLAEKVLAGKSKIEDYFP
EYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLRISTATGDGKHYCYPHFTCAVDTENIR
RVFNDCRDIIQRMHLKQYELL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggggtgtttgggcggcaacagcaagacgacggaagaccagggcgtcgatgaaaaagaa
cgacgcgaggccaacaaaaagatcgagaagcagttgcagaaagagcgcctggcttacaag
gctacccaccgcctgctgctcctgggggctggtgagtctgggaaaagcactatcgtcaaa
cagatgaggatcctgcacgtcaatgggtttaatcccgaggaaaagaaacagaaaattctg
gacatccggaaaaatgttaaagatgctatcgtgacaattgtttcagcaatgagtactata
atacctccagttccgctggccaaccctgaaaaccaatttcgatcagactacatcaagagc
atagcccctatcactgactttgaatattcccaggaattctttgaccatgtgaaaaaactt
tgggacgatgaaggcgtgaaggcatgctttgagagatccaacgaataccagctgattgac
tgtgcacaatacttcctggaaagaatcgacagcgtcagcttggttgactacacacccaca
gaccaggacctcctcagatgcagagttctgacatctgggatttttgagacacgattccaa
gtggacaaagtaaacttccacatgtttgatgttggtggccagagggatgagaggagaaaa
tggatccagtgctttaacgatgtcacagctatcatttacgtcgcagcctgcagtagctac
aacatggtgattcgagaagataacaacaccaacaggctgagagagtccctggatcttttt
gaaagcatctggaacaacaggtggttacggaccatttctatcatcttgttcttgaacaaa
caagatatgctggcagaaaaagtcttggcagggaaatcaaaaattgaagactatttccca
gaatatgcaaattatactgttcctgaagacgcaacaccagatgcaggagaagatcccaaa
gttacaagagccaagttctttatccgggacctgtttttgaggatcagcacggccaccggt
gacggcaaacattactgctacccgcacttcacctgcgccgtggacacagagaacatccgc
agggtgttcaacgactgccgcgacatcatccagcggatgcacctcaagcagtatgagctc
ttgtga

DBGET integrated database retrieval system