KEGG   Homo sapiens (human): 2774Help
Entry
2774              CDS       T01001                                 

Gene name
GNAL, DYT25
Definition
guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type
Orthology
K04633  
guanine nucleotide-binding protein G(olf) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Dopaminergic synapse
Olfactory transduction
Parkinson's disease
Chagas disease (American trypanosomiasis)
Amoebiasis
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18p11.22-p11.21
AA seq 381 aa AA seqDB search
MGCLGGNSKTTEDQGVDEKERREANKKIEKQLQKERLAYKATHRLLLLGAGESGKSTIVK
QMRILHVNGFNPEEKKQKILDIRKNVKDAIVTIVSAMSTIIPPVPLANPENQFRSDYIKS
IAPITDFEYSQEFFDHVKKLWDDEGVKACFERSNEYQLIDCAQYFLERIDSVSLVDYTPT
DQDLLRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIYVAACSSY
NMVIREDNNTNRLRESLDLFESIWNNRWLRTISIILFLNKQDMLAEKVLAGKSKIEDYFP
EYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLRISTATGDGKHYCYPHFTCAVDTENIR
RVFNDCRDIIQRMHLKQYELL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggggtgtttgggcggcaacagcaagacgacggaagaccagggcgtcgatgaaaaagaa
cgacgcgaggccaacaaaaagatcgagaagcagttgcagaaagagcgcctggcttacaag
gctacccaccgcctgctgctcctgggggctggtgagtctgggaaaagcactatcgtcaaa
cagatgaggatcctgcacgtcaatgggtttaatcccgaggaaaagaaacagaaaattctg
gacatccggaaaaatgttaaagatgctatcgtgacaattgtttcagcaatgagtactata
atacctccagttccgctggccaaccctgaaaaccaatttcgatcagactacatcaagagc
atagcccctatcactgactttgaatattcccaggaattctttgaccatgtgaaaaaactt
tgggacgatgaaggcgtgaaggcatgctttgagagatccaacgaataccagctgattgac
tgtgcacaatacttcctggaaagaatcgacagcgtcagcttggttgactacacacccaca
gaccaggacctcctcagatgcagagttctgacatctgggatttttgagacacgattccaa
gtggacaaagtaaacttccacatgtttgatgttggtggccagagggatgagaggagaaaa
tggatccagtgctttaacgatgtcacagctatcatttacgtcgcagcctgcagtagctac
aacatggtgattcgagaagataacaacaccaacaggctgagagagtccctggatcttttt
gaaagcatctggaacaacaggtggttacggaccatttctatcatcttgttcttgaacaaa
caagatatgctggcagaaaaagtcttggcagggaaatcaaaaattgaagactatttccca
gaatatgcaaattatactgttcctgaagacgcaacaccagatgcaggagaagatcccaaa
gttacaagagccaagttctttatccgggacctgtttttgaggatcagcacggccaccggt
gacggcaaacattactgctacccgcacttcacctgcgccgtggacacagagaacatccgc
agggtgttcaacgactgccgcgacatcatccagcggatgcacctcaagcagtatgagctc
ttgtga

DBGET integrated database retrieval system