KEGG   Homo sapiens (human): 278Help
Entry
278               CDS       T01001                                 

Gene name
AMY1C, AMY1
Definition
amylase, alpha 1C (salivary) (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Salivary secretion
Carbohydrate digestion and absorption
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hsa00500]
Organismal Systems; Digestive system; Salivary secretion [PATH:hsa04970]
Organismal Systems; Digestive system; Carbohydrate digestion and absorption [PATH:hsa04973]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p21
AA seq 511 aa AA seqDB search
MKLFWLLFTIGFCWAQYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPP
NENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGN
AVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGL
LDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEG
SKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWP
RYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQP
FTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGI
KIYVSDDGKAHFSISNSAEDPFIAIHAESKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcttttggttgcttttcaccattgggttctgctgggctcagtattcctcaaat
acacaacaaggacgaacatctattgttcatctgtttgaatggcgatgggttgatattgct
cttgaatgtgagcgatatttagctcccaagggatttggaggggttcaggtctctccacca
aatgaaaatgttgccattcacaaccctttcagaccttggtgggaaagataccaaccagtt
agctataaattatgcacaagatctggaaatgaagatgaatttagaaacatggtgactaga
tgcaacaatgttggggttcgtatttatgtggatgctgtaattaatcatatgtgtggtaat
gctgtgagtgcaggaacaagcagtacctgtggaagttacttcaaccctggaagtagggac
tttccagcagtcccatattctggatgggattttaatgatggtaaatgtaaaactggaagt
ggagatatcgagaactataatgatgctactcaggtcagagattgtcgtctgtctggtctt
ctcgatcttgcactggggaaggattatgtgcgttctaagattgccgaatatatgaaccat
ctcattgacattggtgttgcagggttcagaattgatgcttccaagcacatgtggcctgga
gacataaaggcaattttggacaaactgcataatctaaacagtaactggttcccggaaggt
agtaaacctttcatttaccaggaggtaattgatctgggtggtgagccaattaaaagcagt
gactactttggtaatggccgggtgacagaattcaagtatggtgcaaaactcggcacagtt
attcgcaagtggaatggagagaagatgtcttacttaaagaactggggagaaggttggggt
ttcatgccttctgacagagcgcttgtctttgtggataaccatgacaatcaacgaggacat
ggcgctggaggagcctctatacttaccttctgggatgctaggctgtacaaaatggcagtt
ggatttatgcttgctcatccttatggatttacacgagtaatgtcaagctaccgttggcca
agatattttgaaaatggaaaagatgttaatgattgggttgggccaccaaatgataatgga
gtaactaaagaagttactattaatccagacactacttgtggcaatgactgggtctgtgaa
catcgatggcgccaaataaggaacatggttaatttccgcaatgtagtggatggccagcct
tttacaaactggtatgataatgggagcaaccaagtggcttttgggagaggaaacagagga
ttcattgttttcaacaatgatgactggacattttctttaactttgcaaactggtcttcct
gctggcacatactgtgatgtcatttctggagataaaattaatggcaactgcacaggcatt
aaaatctacgtttctgatgatggcaaagctcatttttctattagtaactctgctgaagat
ccatttattgcaattcatgctgaatctaaattgtaa

DBGET integrated database retrieval system