KEGG   Homo sapiens (human): 2782Help
Entry
2782              CDS       T01001                                 

Gene name
GNB1
Definition
guanine nucleotide binding protein (G protein), beta polypeptide 1
Orthology
K04536  
guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Taste transduction
Phototransduction
Morphine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2782 (GNB1)
   04151 PI3K-Akt signaling pathway
    2782 (GNB1)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    2782 (GNB1)
  Nervous system
   04724 Glutamatergic synapse
    2782 (GNB1)
   04727 GABAergic synapse
    2782 (GNB1)
   04725 Cholinergic synapse
    2782 (GNB1)
   04728 Dopaminergic synapse
    2782 (GNB1)
   04726 Serotonergic synapse
    2782 (GNB1)
   04723 Retrograde endocannabinoid signaling
    2782 (GNB1)
  Sensory system
   04744 Phototransduction
    2782 (GNB1)
   04742 Taste transduction
    2782 (GNB1)
  Environmental adaptation
   04713 Circadian entrainment
    2782 (GNB1)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    2782 (GNB1)
   05034 Alcoholism
    2782 (GNB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   2782 (GNB1)
  Exosomal proteins of colorectal cancer cells
   2782 (GNB1)
  Exosomal proteins of melanoma cells
   2782 (GNB1)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    2782 (GNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.33
AA seq 240 aa AA seqDB search
MTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTS
SGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQ
TFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSK
SGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgacctgtgcatatgccccttctgggaactatgtggcctgcggtggcctggataacatt
tgctccatttacaatctgaaaactcgtgaggggaacgtgcgcgtgagtcgtgagctggca
ggacacacaggttacctgtcctgctgccgattcctggatgacaatcagatcgtcaccagc
tctggagacaccacgtgtgccctgtgggacatcgagaccggccagcagacgaccacgttt
accggacacactggagatgtcatgagcctttctcttgctcctgacaccagactgttcgtc
tctggtgcttgtgatgcttcagccaaactctgggatgtgcgagaaggcatgtgccggcag
accttcactggccacgagtctgacatcaatgccatttgcttctttccaaatggcaatgca
tttgccactggctcagacgacgccacctgcaggctgtttgaccttcgtgctgaccaggag
ctcatgacttactcccatgacaacatcatctgcgggatcacctctgtctccttctccaag
agcgggcgcctcctccttgctgggtacgacgacttcaactgcaacgtctgggatgcactc
aaagccgaccgggcaggtgtcttggctgggcatgacaaccgcgtcagctgcctgggcgtg
actgacgatggcatggctgtggcgacagggtcctgggatagcttcctcaagatctggaac
taa

DBGET integrated database retrieval system