KEGG   Homo sapiens (human): 2783Help
Entry
2783              CDS       T01001                                 

Gene name
GNB2
Definition
guanine nucleotide binding protein (G protein), beta polypeptide 2
Orthology
K04537  
guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Morphine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2783 (GNB2)
   04151 PI3K-Akt signaling pathway
    2783 (GNB2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    2783 (GNB2)
  Nervous system
   04724 Glutamatergic synapse
    2783 (GNB2)
   04727 GABAergic synapse
    2783 (GNB2)
   04725 Cholinergic synapse
    2783 (GNB2)
   04728 Dopaminergic synapse
    2783 (GNB2)
   04726 Serotonergic synapse
    2783 (GNB2)
   04723 Retrograde endocannabinoid signaling
    2783 (GNB2)
  Environmental adaptation
   04713 Circadian entrainment
    2783 (GNB2)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    2783 (GNB2)
   05034 Alcoholism
    2783 (GNB2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   2783 (GNB2)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [Table]
    2783 (GNB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q22
AA seq 340 aa AA seqDB search
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNI
CSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGF
AGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYA
FTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAM
KGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctggagcaactgagacaggaggccgagcagctccggaaccagatccgggat
gcccgaaaagcatgtggggactcaacactgacccagatcacagctgggctggacccagtg
gggagaatccagatgaggacccggaggaccctccgtgggcacctggcaaagatctatgcc
atgcactgggggaccgactcaaggctgctggtcagcgcctcccaggatgggaagctcatc
atctgggacagctacaccaccaacaaggtccacgccatcccgctgcgctcctcctgggta
atgacctgtgcctacgcgccctcagggaactttgtggcctgtggggggttggacaacatc
tgctccatctacagcctcaagacccgcgagggcaacgtcagggtcagccgggagctgcct
ggccacactgggtacctgtcgtgttgccgcttcctggatgacaaccaaatcatcaccagc
tctggggataccacctgtgccctgtgggacattgagacaggccagcagacagtgggtttt
gctggacacagtggggatgtgatgtccctgtccctggcccccgatggccgcacgtttgtg
tcaggcgcctgtgatgcctctatcaagctgtgggacgtgcgggattccatgtgccgacag
accttcatcggccatgaatccgacatcaatgcagtggctttcttccccaacggctacgcc
ttcaccaccggctctgacgacgccacgtgccgcctcttcgacctgcgggccgatcaggag
ctcctcatgtactcccatgacaacatcatctgtggcatcacctctgttgccttctcgcgc
agcggacggctgctgctcgctggctacgacgacttcaactgcaacatctgggatgccatg
aagggcgaccgtgcaggagtcctcgctggccacgacaaccgcgtgagctgcctcggggtc
accgacgatggcatggctgtggccacgggctcctgggactccttcctcaagatctggaac
taa

DBGET integrated database retrieval system