KEGG   Homo sapiens (human): 2785Help
Entry
2785              CDS       T01001                                 

Gene name
GNG3
Definition
guanine nucleotide binding protein (G protein), gamma 3
Orthology
K04540  
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Taste transduction
Morphine addiction
Alcoholism
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2785 (GNG3)
   04151 PI3K-Akt signaling pathway
    2785 (GNG3)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    2785 (GNG3)
  Nervous system
   04724 Glutamatergic synapse
    2785 (GNG3)
   04727 GABAergic synapse
    2785 (GNG3)
   04725 Cholinergic synapse
    2785 (GNG3)
   04728 Dopaminergic synapse
    2785 (GNG3)
   04726 Serotonergic synapse
    2785 (GNG3)
   04723 Retrograde endocannabinoid signaling
    2785 (GNG3)
  Sensory system
   04742 Taste transduction
    2785 (GNG3)
  Environmental adaptation
   04713 Circadian entrainment
    2785 (GNG3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2785 (GNG3)
  Substance dependence
   05032 Morphine addiction
    2785 (GNG3)
   05034 Alcoholism
    2785 (GNG3)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    2785 (GNG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p11
AA seq 75 aa AA seqDB search
MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPT
SENPFREKKFFCALL
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtgagaccccggtgaacagcactatgagtattgggcaagcacgcaagatggtg
gaacagcttaagattgaagccagcttgtgtcggataaaggtgtccaaggcagcagcagac
ctgatgacttactgtgatgcccacgcctgtgaggatcccctcatcacccctgtgcccact
tcggagaaccccttccgggagaagaagttcttctgtgctctcctctga

DBGET integrated database retrieval system