KEGG   Homo sapiens (human): 2786Help
Entry
2786              CDS       T01001                                 

Gene name
GNG4
Definition
guanine nucleotide binding protein (G protein), gamma 4
Orthology
K04541  
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Morphine addiction
Alcoholism
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2786 (GNG4)
   04151 PI3K-Akt signaling pathway
    2786 (GNG4)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    2786 (GNG4)
  Nervous system
   04724 Glutamatergic synapse
    2786 (GNG4)
   04727 GABAergic synapse
    2786 (GNG4)
   04725 Cholinergic synapse
    2786 (GNG4)
   04728 Dopaminergic synapse
    2786 (GNG4)
   04726 Serotonergic synapse
    2786 (GNG4)
   04723 Retrograde endocannabinoid signaling
    2786 (GNG4)
  Environmental adaptation
   04713 Circadian entrainment
    2786 (GNG4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2786 (GNG4)
  Substance dependence
   05032 Morphine addiction
    2786 (GNG4)
   05034 Alcoholism
    2786 (GNG4)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    2786 (GNG4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
1q42.3
AA seq 75 aa AA seqDB search
MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPA
SENPFREKKFFCTIL
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagggcatgtctaataacagcaccactagcatctcccaagccaggaaagctgtg
gagcagctaaagatggaagcctgtatggacagggtcaaggtctcccaggcagctgcggac
ctcctggcctactgtgaagctcacgtgcgggaagatcctctcatcattccagtgcctgca
tcagaaaacccctttcgcgagaagaagttcttttgtaccattctctaa

DBGET integrated database retrieval system