KEGG   Homo sapiens (human): 2787Help
Entry
2787              CDS       T01001                                 

Gene name
GNG5
Definition
guanine nucleotide binding protein (G protein), gamma 5
Orthology
K04542  
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Morphine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2787 (GNG5)
   04151 PI3K-Akt signaling pathway
    2787 (GNG5)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    2787 (GNG5)
  Nervous system
   04724 Glutamatergic synapse
    2787 (GNG5)
   04727 GABAergic synapse
    2787 (GNG5)
   04725 Cholinergic synapse
    2787 (GNG5)
   04728 Dopaminergic synapse
    2787 (GNG5)
   04726 Serotonergic synapse
    2787 (GNG5)
   04723 Retrograde endocannabinoid signaling
    2787 (GNG5)
  Environmental adaptation
   04713 Circadian entrainment
    2787 (GNG5)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    2787 (GNG5)
   05034 Alcoholism
    2787 (GNG5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   2787 (GNG5)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    2787 (GNG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p22
AA seq 68 aa AA seqDB search
MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFR
PQKVCSFL
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atgtctggctcctccagcgtcgccgctatgaagaaagtggttcaacagctccggctggag
gccggactcaaccgcgtaaaagtttcccaggcagctgcagacttgaaacagttctgtctg
cagaatgctcaacatgaccctctgctgactggagtatcttcaagtacaaatcccttcaga
ccccagaaagtctgttcctttttgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system