KEGG   Homo sapiens (human): 2788Help
Entry
2788              CDS       T01001                                 

Gene name
GNG7
Definition
guanine nucleotide binding protein (G protein), gamma 7
Orthology
K04543  
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Morphine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2788 (GNG7)
   04151 PI3K-Akt signaling pathway
    2788 (GNG7)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    2788 (GNG7)
  Nervous system
   04724 Glutamatergic synapse
    2788 (GNG7)
   04727 GABAergic synapse
    2788 (GNG7)
   04725 Cholinergic synapse
    2788 (GNG7)
   04728 Dopaminergic synapse
    2788 (GNG7)
   04726 Serotonergic synapse
    2788 (GNG7)
   04723 Retrograde endocannabinoid signaling
    2788 (GNG7)
  Environmental adaptation
   04713 Circadian entrainment
    2788 (GNG7)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    2788 (GNG7)
   05034 Alcoholism
    2788 (GNG7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   2788 (GNG7)
  Exosomal proteins of other body fluids (saliva and urine)
   2788 (GNG7)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [Table]
    2788 (GNG7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 68 aa AA seqDB search
MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFK
DKKPCIIL
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccactaacaacatagcccaggcccggaagctggtggaacagctacgcatagaa
gccgggattgagcgcatcaaggtctccaaagcggcgtctgacctcatgagctactgtgag
caacatgcccggaacgaccccctgctggtcggagtccctgcctcggagaacccctttaag
gacaagaaaccttgtattattttataa

DBGET integrated database retrieval system