KEGG   Homo sapiens (human): 2790Help
Entry
2790              CDS       T01001                                 

Gene name
GNG10
Definition
guanine nucleotide binding protein (G protein), gamma 10
Orthology
K04545  
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Morphine addiction
Alcoholism
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2790 (GNG10)
   04151 PI3K-Akt signaling pathway
    2790 (GNG10)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    2790 (GNG10)
  Nervous system
   04724 Glutamatergic synapse
    2790 (GNG10)
   04727 GABAergic synapse
    2790 (GNG10)
   04725 Cholinergic synapse
    2790 (GNG10)
   04728 Dopaminergic synapse
    2790 (GNG10)
   04726 Serotonergic synapse
    2790 (GNG10)
   04723 Retrograde endocannabinoid signaling
    2790 (GNG10)
  Environmental adaptation
   04713 Circadian entrainment
    2790 (GNG10)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2790 (GNG10)
  Substance dependence
   05032 Morphine addiction
    2790 (GNG10)
   05034 Alcoholism
    2790 (GNG10)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    2790 (GNG10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
9q31.3
AA seq 68 aa AA seqDB search
MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFR
EPRSCALL
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccggggctagcgcgagcgccctgcagcgcttggtagagcagctcaagttggag
gctggcgtggagaggatcaaggtctctcaggcagctgcagagcttcaacagtactgtatg
cagaatgcctgcaaggatgccctgctggtgggtgttccagctggaagtaaccccttccgg
gagcctagatcctgtgctttactctga

DBGET integrated database retrieval system