KEGG   Homo sapiens (human): 2791Help
Entry
2791              CDS       T01001                                 

Gene name
GNG11, GNGT11
Definition
guanine nucleotide binding protein (G protein), gamma 11
Orthology
K04546  
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Morphine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2791 (GNG11)
   04151 PI3K-Akt signaling pathway
    2791 (GNG11)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    2791 (GNG11)
  Nervous system
   04724 Glutamatergic synapse
    2791 (GNG11)
   04727 GABAergic synapse
    2791 (GNG11)
   04725 Cholinergic synapse
    2791 (GNG11)
   04728 Dopaminergic synapse
    2791 (GNG11)
   04726 Serotonergic synapse
    2791 (GNG11)
   04723 Retrograde endocannabinoid signaling
    2791 (GNG11)
  Environmental adaptation
   04713 Circadian entrainment
    2791 (GNG11)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    2791 (GNG11)
   05034 Alcoholism
    2791 (GNG11)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    2791 (GNG11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
7q21
AA seq 73 aa AA seqDB search
MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPED
KNPFKEKGSCVIS
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcccttcacatcgaagatttgccagagaaggaaaaactgaaaatggaagttgag
cagcttcgcaaagaagtgaagttgcagagacaacaagtgtctaaatgttctgaagaaata
aagaactatattgaagaacgttctggagaggatcctctagtaaagggaattccagaagac
aagaacccctttaaagaaaaaggcagctgtgttatttcataa

DBGET integrated database retrieval system