KEGG   Homo sapiens (human): 2792Help
Entry
2792              CDS       T01001                                 

Gene name
GNGT1, GNG1
Definition
guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1
Orthology
K04548  
guanine nucleotide-binding protein G(T) subunit gamma-T1
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Phototransduction
Morphine addiction
Alcoholism
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:hsa04724]
Organismal Systems; Nervous system; GABAergic synapse [PATH:hsa04727]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:hsa04725]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:hsa04723]
Organismal Systems; Sensory system; Phototransduction [PATH:hsa04744]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:hsa04713]
Human Diseases; Substance dependence; Morphine addiction [PATH:hsa05032]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q21.3
AA seq 74 aa AA seqDB search
MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPED
KNPFKELKGGCVIS
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgccagtaatcaatattgaggacctgacagaaaaggacaaattgaagatggaagttgac
cagctcaagaaagaagtgacactggaaagaatgctagtttccaaatgttgtgaagaagta
agagattacgttgaagaacgatctggcgaggatccactggtaaagggcatcccagaggac
aaaaatcccttcaaggagctcaaaggaggctgtgtgatttcataa

DBGET integrated database retrieval system