KEGG   Homo sapiens (human): 2793Help
Entry
2793              CDS       T01001                                 

Gene name
GNGT2, G-GAMMA-8, G-GAMMA-C, GNG8, GNG9, GNGT8
Definition
guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2
Orthology
K04549  
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Morphine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2793 (GNGT2)
   04151 PI3K-Akt signaling pathway
    2793 (GNGT2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    2793 (GNGT2)
  Nervous system
   04724 Glutamatergic synapse
    2793 (GNGT2)
   04727 GABAergic synapse
    2793 (GNGT2)
   04725 Cholinergic synapse
    2793 (GNGT2)
   04728 Dopaminergic synapse
    2793 (GNGT2)
   04726 Serotonergic synapse
    2793 (GNGT2)
   04723 Retrograde endocannabinoid signaling
    2793 (GNGT2)
  Environmental adaptation
   04713 Circadian entrainment
    2793 (GNGT2)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    2793 (GNGT2)
   05034 Alcoholism
    2793 (GNGT2)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    2793 (GNGT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21
AA seq 69 aa AA seqDB search
MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPF
KEKGGCLIS
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggatctcagcgagaaggacctgttgaagatggaggtggagcagctgaagaaa
gaagtgaaaaacacaagaattccgatttccaaagcgggaaaggaaatcaaggagtacgtg
gaggcccaagcaggaaacgatccttttctcaaaggcatccctgaggacaagaatcccttc
aaggagaaaggtggctgtctgataagctga

DBGET integrated database retrieval system