KEGG   Homo sapiens (human): 2798Help
Entry
2798              CDS       T01001                                 

Gene name
GNRHR, GNRHR1, GRHR, HH7, LHRHR, LRHR
Definition
(RefSeq) gonadotropin releasing hormone receptor
  KO
K04280  
gonadotropin-releasing hormone receptor
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
GnRH signaling pathway
Disease
H00255  
Hypogonadotropic hypogonadism
Drug target
Gonadorelin [DG:DG00499]: 
Nafarelin [DG:DG00500]: 
Ganirelix [DG:DG00504]: 
Cetrorelix [DG:DG00505]: 
Buserelin [DG:DG00729]: 
Leuprorelin [DG:DG00730]: 
Goserelin [DG:DG00731]: 
Triptorelin [DG:DG00732]: 
Histrelin [DG:DG00733]: 
Abarelix: 
Degarelix [DG:DG00736]: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2798 (GNRHR)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    2798 (GNRHR)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Hypothalamic hormone
   Gonadotropin-releasing hormone
    2798 (GNRHR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
4q21.2
AA seq 328 aa AA seqDB search
MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKL
QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRM
IHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTR
VLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRL
SDPVNHFFFLFAFLNPCFDPLIYGYFSL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacagtgcctctcctgaacagaatcaaaatcactgttcagccatcaacaacagc
atcccactgatgcagggcaacctccccactctgaccttgtctggaaagatccgagtgacg
gttactttcttcctttttctgctctctgcgacctttaatgcttctttcttgttgaaactt
cagaagtggacacagaagaaagagaaagggaaaaagctctcaagaatgaagctgctctta
aaacatctgaccttagccaacctgttggagactctgattgtcatgccactggatgggatg
tggaacattacagtccaatggtatgctggagagttactctgcaaagttctcagttatcta
aagcttttctccatgtatgccccagccttcatgatggtggtgatcagcctggaccgctcc
ctggctatcacgaggcccctagctttgaaaagcaacagcaaagtcggacagtccatggtt
ggcctggcctggatcctcagtagtgtctttgcaggaccacagttatacatcttcaggatg
attcatctagcagacagctctggacagacaaaagttttctctcaatgtgtaacacactgc
agtttttcacaatggtggcatcaagcattttataactttttcaccttcagctgcctcttc
atcatccctcttttcatcatgctgatctgcaatgcaaaaatcatcttcaccctgacacgg
gtccttcatcaggacccccacgaactacaactgaatcagtccaagaacaatataccaaga
gcacggctgaagactctaaaaatgacggttgcatttgccacttcatttactgtctgctgg
actccctactatgtcctaggaatttggtattggtttgatcctgaaatgttaaacaggttg
tcagacccagtaaatcacttcttctttctctttgcctttttaaacccatgctttgatcca
cttatctatggatatttttctctgtga

DBGET integrated database retrieval system