KEGG   Homo sapiens (human): 2803Help
Entry
2803              CDS       T01001                                 

Gene name
GOLGA4, CRPF46, GCP2, GOLG, MU-RMS-40.18, p230
Definition
golgin A4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p22-p21.3
AA seq 2243 aa AA seqDB search
MFKKLKQKISEEQQQLQQALAPAQASSNSSTPTRMRSRTSSFTEQLDEGTPNRENASTHA
SKSPDSVNGSEPSIPQSGDTQSFAQKLQLRVPSVESLFRSPIKESLFRSSSKESLVRTSS
RESLNRLDLDSSTASFDPPSDMDSEAEDLVGNSDSLNKEQLIQRLRRMERSLSSYRGKYS
ELVTAYQMLQREKKKLQGILSQSQDKSLRRIAELREELQMDQQAKKHLQEEFDASLEEKD
QYISVLQTQVSLLKQRLRNGPMNVDVLKPLPQLEPQAEVFTKEENPESDGEPVVEDGTSV
KTLETLQQRVKRQENLLKRCKETIQSHKEQCTLLTSEKEALQEQLDERLQELEKIKDLHM
AEKTKLITQLRDAKNLIEQLEQDKGMVIAETKRQMHETLEMKEEEIAQLRSRIKQMTTQG
EELREQKEKSERAAFEELEKALSTAQKTEEARRKLKAEMDEQIKTIEKTSEEERISLQQE
LSRVKQEVVDVMKKSSEEQIAKLQKLHEKELARKEQELTKKLQTREREFQEQMKVALEKS
QSEYLKISQEKEQQESLALEELELQKKAILTESENKLRDLQQEAETYRTRILELESSLEK
SLQENKNQSKDLAVHLEAEKNKHNKEITVMVEKHKTELESLKHQQDALWTEKLQVLKQQY
QTEMEKLREKCEQEKETLLKDKEIIFQAHIEEMNEKTLEKLDVKQTELESLSSELSEVLK
ARHKLEEELSVLKDQTDKMKQELEAKMDEQKNHHQQQVDSIIKEHEVSIQRTEKALKDQI
NQLELLLKERDKHLKEHQAHVENLEADIKRSEGELQQASAKLDVFQSYQSATHEQTKAYE
EQLAQLQQKLLDLETERILLTKQVAEVEAQKKDVCTELDAHKIQVQDLMQQLEKQNSEME
QKVKSLTQVYESKLEDGNKEQEQTKQILVEKENMILQMREGQKKEIEILTQKLSAKEDSI
HILNEEYETKFKNQEKKMEKVKQKAKEMQETLKKKLLDQEAKLKKELENTALELSQKEKQ
FNAKMLEMAQANSAGISDAVSRLETNQKEQIESLTEVHRRELNDVISIWEKKLNQQAEEL
QEIHEIQLQEKEQEVAELKQKILLFGCEKEEMNKEITWLKEEGVKQDTTLNELQEQLKQK
SAHVNSLAQDETKLKAHLEKLEVDLNKSLKENTFLQEQLVELKMLAEEDKRKVSELTSKL
KTTDEEFQSLKSSHEKSNKSLEDKSLEFKKLSEELAIQLDICCKKTEALLEAKTNELINI
SSSKTNAILSRISHCQHRTTKVKEALLIKTCTVSELEAQLRQLTEEQNTLNISFQQATHQ
LEEKENQIKSMKADIESLVTEKEALQKEGGNQQQAASEKESCITQLKKELSENINAVTLM
KEELKEKKVEISSLSKQLTDLNVQLQNSISLSEKEAAISSLRKQYDEEKCELLDQVQDLS
FKVDTLSKEKISALEQVDDWSNKFSEWKKKAQSRFTQHQNTVKELQIQLELKSKEAYEKD
EQINLLKEELDQQNKRFDCLKGEMEDDKSKMEKKESNLETELKSQTARIMELEDHITQKT
IEIESLNEVLKNYNQQKDIEHKELVQKLQHFQELGEEKDNRVKEAEEKILTLENQVYSMK
AELETKKKELEHVNLSVKSKEEELKALEDRLESESAAKLAELKRKAEQKIAAIKKQLLSQ
MEEKEEQYKKGTESHLSELNTKLQEREREVHILEEKLKSVESSQSETLIVPRSAKNVAAY
TEQEEADSQGCVQKTYEEKISVLQRNLTEKEKLLQRVGQEKEETVSSHFEMRCQYQERLI
KLEHAEAKQHEDQSMIGHLQEELEEKNKKYSLIVAQHVEKEGGKNNIQAKQNLENVFDDV
QKTLQEKELTCQILEQKIKELDSCLVRQKEVHRVEMEELTSKYEKLQALQQMDGRNKPTE
LLEENTEEKSKSHLVQPKLLSNMEAQHNDLEFKLAGAEREKQKLGKEIVRLQKDLRMLRK
EHQQELEILKKEYDQEREEKIKQEQEDLELKHNSTLKQLMREFNTQLAQKEQELEMTIKE
TINKAQEVEAELLESHQEETNQLLKKIAEKDDDLKRTAKRYEEILDAREEEMTAKVRDLQ
TQLEELQKKYQQKLEQEENPGNDNTQLAQKTTLISDSKLKEQEFREQIHNLEDRLKKYEK
NVYATTVGTPYKGGNLYHTDVSLFGEPTEFEYLRKVLFEYMMGRETKTMAKVITTVLKFP
DDQTQKILEREDARLMSWLRSSS
NT seq 6732 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagaaactgaagcaaaagatcagcgaggagcagcagcagctccagcaggcgctg
gctcctgctcaggcgtcctccaattcttcaacaccaacaagaatgaggagcaggacatct
tcatttacagagcaacttgatgaaggtacacccaatagagagaatgcatctactcatgcc
tcgaaatctcctgacagtgttaatggaagtgaaccaagcattcctcagtcaggtgacaca
cagtcttttgcacagaagctccagctccgggtgccctccgtggagtctttgtttcgaagt
ccgataaaggaatctctattccggtcttcttctaaagagtctttggtacgaacatcttcc
agagaatccctgaatcgacttgacctggacagttctactgccagttttgatccaccctct
gatatggatagcgaggctgaagacttggtagggaattcagacagtctcaacaaagaacag
ttgattcagcggttgcgaagaatggaacgaagcttaagtagctacaggggaaaatattct
gagcttgttacagcttatcagatgcttcagagagagaagaaaaagctacaaggtatatta
agtcagagtcaggataaatcacttcggagaatagcagaattaagagaggagctccaaatg
gaccagcaggcaaagaaacatctgcaagaggagtttgatgcatctttagaggagaaagat
cagtatatcagtgttctccaaactcaggtttctctactgaaacaacgattacgaaatggc
ccgatgaatgttgatgtactgaaaccacttcctcagctggaaccacaggctgaagtcttc
actaaagaagagaatccagaaagtgatggagagccagtagtggaagatggaacttctgta
aaaacactggaaacactccagcaaagagtgaagcgtcaagagaacctacttaagcgttgt
aaggaaacaattcagtcacataaggaacaatgtacactattaactagtgaaaaagaagct
ctgcaagaacaactggatgaaagacttcaagaactagaaaagataaaggaccttcatatg
gccgagaagactaaacttatcactcagttgcgtgatgcaaagaacttaattgaacagctt
gaacaagataagggaatggtaatcgcagagacaaaacgtcagatgcatgaaaccctggaa
atgaaagaagaagaaattgctcaactccgtagtcgcatcaaacagatgactacccaggga
gaggaattacgggaacagaaagaaaagtccgaaagagctgcttttgaggaacttgaaaaa
gctttgagtacagcccaaaaaacagaggaagcacggagaaaactgaaggcagaaatggat
gaacaaataaaaactatcgaaaaaacaagtgaggaggaacgcatcagtcttcaacaggaa
ttaagtcgggtgaaacaggaggttgttgatgtaatgaaaaaatcctcagaagaacaaatt
gctaagctacagaagcttcatgaaaaggagctggccagaaaagagcaggaactgaccaag
aagcttcagacccgagaaagggaatttcaggaacaaatgaaagtagctcttgaaaagagt
caatcagaatatttgaagatcagccaagaaaaagaacagcaagaatctttggccctagaa
gagttagagttgcagaaaaaagcaatcctcacagaaagtgaaaataaacttcgggacctt
cagcaagaagcagagacttacagaactagaattcttgaattggaaagttctttggaaaaa
agcttacaagaaaacaaaaatcagtcaaaagatttggctgttcatctggaagctgaaaaa
aataagcacaataaggagattacagtcatggttgaaaaacacaagacagaattggaaagc
cttaagcatcagcaggatgccctttggactgaaaaactccaagtcttaaagcaacaatat
cagactgaaatggaaaaacttagggaaaagtgtgaacaagaaaaagaaacattgttgaaa
gacaaagagattatcttccaggcccacatagaagaaatgaatgaaaagactttagaaaag
cttgatgtgaagcaaacagaactagaatcattatcttctgaactgtcagaagtattaaaa
gcccgtcacaaactagaagaggaactttctgttctgaaagatcaaacagataaaatgaag
caggaattagaggccaagatggatgaacagaaaaatcatcaccagcagcaagttgacagt
atcattaaagaacacgaggtatctatccagaggactgagaaggcattaaaagatcaaatt
aatcaacttgagcttctcttgaaggaaagggacaagcatttgaaagagcatcaggctcat
gtagaaaatttagaggcagatattaaaaggtctgaaggggaactccagcaggcatctgct
aagctggacgtttttcagtcttaccagagtgccacacatgagcagacaaaagcatatgag
gaacagttggcccaattgcagcagaagttgttggatttggaaacagaaagaattcttctt
accaaacaggttgctgaagttgaagcacaaaagaaagatgtttgtactgagttagatgct
cacaaaatccaggtgcaggacttaatgcagcaacttgaaaaacaaaatagtgaaatggag
caaaaagtaaaatctttaacccaagtctatgagtccaaacttgaagatggtaacaaagaa
caggaacagacaaagcaaatcttggtggaaaaggaaaatatgattttacaaatgagagaa
ggacagaagaaagaaattgagatactcacacagaaattgtcagccaaggaggacagtatt
catattttgaatgaggaatatgaaaccaaatttaaaaaccaagaaaaaaagatggaaaaa
gttaagcagaaagcaaaggagatgcaagaaacgttaaagaaaaaattactggatcaggaa
gccaaacttaagaaagagcttgaaaatactgctctagagcttagtcagaaagaaaaacag
tttaatgccaaaatgctggaaatggcacaggctaactcagctggaatcagtgatgcagtg
tcaagactggaaacaaaccaaaaagaacaaatagaaagtcttactgaggttcatcgacga
gaactcaatgatgtcatatcaatctgggaaaagaaacttaatcagcaagctgaagaactt
caggaaatacatgaaatccaattacaggaaaaagaacaagaggtagcagaactgaaacaa
aagatcctcctatttgggtgtgaaaaagaagagatgaacaaggaaataacatggctgaag
gaagaaggtgttaagcaggatacaacattaaatgaattacaggaacagttaaagcagaag
tctgcccatgtgaattctcttgcacaagatgaaactaaactgaaagctcatcttgaaaag
ctagaggttgacttgaataagtctctgaaggaaaatacttttcttcaagagcagctagtt
gaactgaagatgctggcagaagaagataagcggaaggtttctgagttgactagcaagttg
aaaaccacagatgaagaattccagagtttgaaatcttcacatgaaaaaagtaacaaaagc
ctagaggacaagagcttggaatttaaaaaactgtctgaggaactagcgattcagctagat
atttgctgtaagaaaaccgaagccttattagaagctaaaacaaatgagctaatcaacatt
agtagtagtaaaactaatgccattctttctaggatttctcattgtcagcaccgtacaact
aaagttaaggaggcactgttaattaaaacttgcacagtttctgaattagaagcacaactt
agacagttgacagaggagcaaaatacactaaatatttcttttcaacaggctactcatcag
ttagaagaaaaagaaaatcaaattaagagcatgaaggctgatattgaaagtcttgtaaca
gaaaaagaagccttacagaaggaaggaggcaatcagcaacaggctgcttctgaaaaggag
tcttgtataacacagttgaagaaagagttatctgaaaacatcaatgctgtcacattgatg
aaagaagagcttaaagaaaaaaaagttgagattagcagtcttagtaaacaactaactgat
ttgaatgttcagcttcaaaatagcatcagcctatccgaaaaagaagcagccatttcatca
ctaagaaagcagtatgatgaagaaaaatgtgaattgctggatcaggtgcaagatttatct
tttaaagttgacactctgagtaaagagaaaatttctgctcttgagcaggtagatgactgg
tccaataaattctcagaatggaagaagaaagcacagtcaagatttacacagcatcaaaac
actgttaaagaattgcagatccagcttgagttaaaatcaaaggaagcttatgaaaaggat
gagcagataaatttattgaaggaagagcttgatcagcaaaataaaagatttgattgttta
aagggtgaaatggaagacgacaagagcaagatggagaaaaaggagtctaatttagaaaca
gagttaaagtctcaaacagcaagaattatggaattagaggaccatattacccagaaaact
attgaaatagagtccttaaatgaagttcttaaaaattacaatcaacaaaaggatattgaa
cacaaagaattggttcagaaacttcaacattttcaagagttaggagaagaaaaggacaac
agggttaaagaagctgaagaaaaaatcttaacacttgaaaaccaagtttattccatgaaa
gctgaacttgaaactaagaagaaagaattagaacatgtgaatttaagtgtgaaaagcaaa
gaggaggagttaaaggcattggaagataggcttgagtcagaaagtgctgcaaaattagca
gagttgaagagaaaagctgaacaaaaaattgctgccattaagaagcagttgttatctcaa
atggaagagaaagaagaacagtataaaaaaggtacagaaagccatttgagtgagctaaat
acaaaattgcaggaaagagaaagggaagttcacatcttggaagaaaaacttaagtcagtg
gaaagttcacagtcagaaacattaattgtacccagatcagcaaaaaatgtggcagcatat
actgaacaagaagaagcagattcccaaggctgtgtgcagaagacatatgaagaaaaaatc
agtgttttacaaagaaacttaactgaaaaagaaaagctattgcagagggtagggcaggaa
aaagaagagacagtttcttctcattttgaaatgcgatgccaataccaggagcgcttaata
aagctagaacatgctgaggcaaagcaacatgaagatcaaagtatgataggtcatcttcaa
gaggagcttgaagaaaaaaacaagaaatattccttgatagtagcccagcatgtggaaaaa
gaaggaggtaaaaataacatacaggcaaagcaaaacttggaaaatgtgtttgacgacgtc
cagaaaaccctccaggagaaggaactaacctgtcagattttggagcaaaagataaaagag
ctggattcctgcttagtaagacagaaagaagtacatagagttgaaatggaagagttgacc
tcaaaatatgaaaaattacaggctttacaacagatggatggaagaaataaacccacagaa
cttttggaagaaaacactgaagaaaagtccaaatcacatttggtccaacccaaattgctt
agtaacatggaagcccagcacaatgatctggagtttaaattagccggggcagaacgggag
aaacagaaactgggcaaggagattgttagattgcagaaagaccttcgaatgttgagaaag
gagcatcagcaagaattggaaatactaaagaaagaatatgatcaagaaagggaagagaaa
atcaaacaggagcaggaagatcttgaactgaagcacaattccacattaaaacagctgatg
agggagtttaatacacagctggcacaaaaggaacaagagctggaaatgaccataaaagaa
actatcaataaggcccaggaggtggaggctgaacttttagaaagccatcaagaagagaca
aatcagttacttaaaaaaattgctgagaaagatgatgatctaaaacgaacagccaaaaga
tatgaagaaatccttgatgctcgtgaagaagaaatgactgcaaaagtaagggacctgcag
actcaacttgaggagctgcagaagaaataccagcaaaagctagagcaggaggagaaccct
ggcaatgataatacacagctagcacagaagacgactttaatcagtgattcgaaattgaaa
gagcaagagttcagagaacagattcacaatttagaagaccgtttgaagaaatatgaaaag
aatgtatatgcaacaactgtggggacaccttacaaaggtggcaatttgtaccatacggat
gtctcactctttggagaacctaccgaatttgagtatttgcgaaaagtgctttttgagtat
atgatgggtcgtgagactaagaccatggcaaaagttataaccaccgtactgaagttccct
gatgatcagactcagaaaattttggaaagagaagatgctcggctgatgtcatggctccga
tcttcatcttga

DBGET integrated database retrieval system