KEGG   Homo sapiens (human): 2806Help
Entry
2806              CDS       T01001                                 

Gene name
GOT2, KAT4, KATIV, KYAT4, mitAAT
Definition
(RefSeq) glutamic-oxaloacetic transaminase 2
  KO
K14455  
aspartate aminotransferase, mitochondrial [EC:2.6.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Cysteine and methionine metabolism
Arginine and proline metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    2806 (GOT2)
   01210 2-Oxocarboxylic acid metabolism
    2806 (GOT2)
   01230 Biosynthesis of amino acids
    2806 (GOT2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    2806 (GOT2)
   00270 Cysteine and methionine metabolism
    2806 (GOT2)
   00220 Arginine biosynthesis
    2806 (GOT2)
   00330 Arginine and proline metabolism
    2806 (GOT2)
   00350 Tyrosine metabolism
    2806 (GOT2)
   00360 Phenylalanine metabolism
    2806 (GOT2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    2806 (GOT2)
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    2806 (GOT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     2806 (GOT2)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class I
   2806 (GOT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P00505(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
16q21
AA seq 430 aa AA seqDB search
MALLHSGRVLPGIAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKM
NLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEV
LKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYR
YYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFA
FFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADE
AKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVS
NLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGY
LAHAIHQVTK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggccctgctgcactccggccgcgtcctccccgggatcgccgccgccttccacccgggc
ctcgccgccgcggcctctgccagagccagctcctggtggacccatgtggaaatgggacct
ccagatcccattctgggagtcactgaagcctttaagagggacaccaatagcaaaaagatg
aatctgggagttggtgcctaccgggatgataatggaaagccttacgttctgcctagcgtc
cgcaaggcagaggcccagattgccgcaaaaaatttggacaaggaatacctgcccattggg
ggactggctgaattttgcaaggcatctgcagaactagccctgggtgagaacagcgaagtc
ttgaagagtggccggtttgtcactgtgcagaccatttctggaactggagccttaaggatc
ggagccagttttctgcaaagattttttaagttcagccgagatgtctttctgcccaaacca
acctggggaaaccacacacccatcttcagggatgctggcatgcagctacaaggttatcgg
tattatgaccccaagacttgcggttttgacttcacaggcgctgtggaggatatttcaaaa
ataccagagcagagtgttcttcttctgcatgcctgcgcccacaatcccacgggagtggac
ccgcgtccggaacagtggaaggaaatagcaacagtggtgaagaaaaggaatctctttgcg
ttctttgacatggcctaccaaggctttgccagtggtgatggtgataaggatgcctgggct
gtgcgccacttcatcgaacagggcattaatgtttgcctctgccaatcatatgccaagaac
atgggcttatatggtgagcgtgtaggagccttcactatggtctgcaaagatgcggatgaa
gccaaaagggtagagtcacagttgaagatcttgatccgtcccatgtattccaaccctccc
ctcaatggggcccggattgctgctgccattctgaacaccccagatttgcgaaaacaatgg
ctgcaagaagtgaaagtcatggctgaccgcatcattggcatgcggactcaactggtctcc
aacctcaagaaggagggttccacccacaattggcaacacatcaccgaccaaattggcatg
ttctgtttcacagggctaaagcctgaacaggtggagcggctgatcaaggagttctccatc
tacatgacaaaagatggccgcatctctgtggcaggggtcacctccagcaacgtgggctac
cttgcccatgccattcaccaggtcaccaagtaa

DBGET integrated database retrieval system