KEGG   Homo sapiens (human): 2810Help
Entry
2810              CDS       T01001                                 

Gene name
SFN, YWHAS
Definition
(RefSeq) stratifin
  KO
K06644  stratifin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04115  p53 signaling pathway
hsa04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    2810 (SFN)
   04115 p53 signaling pathway
    2810 (SFN)
 Organismal Systems
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    2810 (SFN)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2810 (SFN)
  Exosomal proteins of colorectal cancer cells
   2810 (SFN)
  Exosomal proteins of bladder cancer cells
   2810 (SFN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 SIKE Peptidase_C98
Motif
Other DBs
NCBI-GeneID: 2810
NCBI-ProteinID: NP_006133
OMIM: 601290
HGNC: 10773
Ensembl: ENSG00000175793
Vega: OTTHUMG00000004093
Pharos: P31947(Tbio)
UniProt: P31947
Structure
PDB: 

Jmol
Position
1p36.11
AA seq 248 aa AA seqDB search
MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWR
VLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFY
LKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFH
YEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGG
EAPQEPQS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggagagagccagtctgatccagaaggccaagctggcagagcaggccgaacgctatgag
gacatggcagccttcatgaaaggcgccgtggagaagggcgaggagctctcctgcgaagag
cgaaacctgctctcagtagcctataagaacgtggtgggcggccagagggctgcctggagg
gtgctgtccagtattgagcagaaaagcaacgaggagggctcggaggagaaggggcccgag
gtgcgtgagtaccgggagaaggtggagactgagctccagggcgtgtgcgacaccgtgctg
ggcctgctggacagccacctcatcaaggaggccggggacgccgagagccgggtcttctac
ctgaagatgaagggtgactactaccgctacctggccgaggtggccaccggtgacgacaag
aagcgcatcattgactcagcccggtcagcctaccaggaggccatggacatcagcaagaag
gagatgccgcccaccaaccccatccgcctgggcctggccctgaacttttccgtcttccac
tacgagatcgccaacagccccgaggaggccatctctctggccaagaccactttcgacgag
gccatggctgatctgcacaccctcagcgaggactcctacaaagacagcaccctcatcatg
cagctgctgcgagacaacctgacactgtggacggccgacaacgccggggaagaggggggc
gaggctccccaggagccccagagctga

DBGET integrated database retrieval system