KEGG   Homo sapiens (human): 2815Help
Entry
2815              CDS       T01001                                 

Gene name
GP9, CD42a, GPIX
Definition
glycoprotein IX (platelet)
Orthology
K06263  
platelet glycoprotein IX
Organism
hsa  Homo sapiens (human)
Pathway
ECM-receptor interaction
Platelet activation
Hematopoietic cell lineage
Disease
H00224  
Bernard-Soulier syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    2815 (GP9)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    2815 (GP9)
   04611 Platelet activation
    2815 (GP9)
Cellular antigens [BR:hsa04090]
 Proteins
  2815 (GP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q21.3
AA seq 177 aa AA seqDB search
MPAWGALFLLWATAEATKDCPSPCTCRALETMGLWVDCRGHGLTALPALPARTRHLLLAN
NSLQSVPPGAFDHLPQLQTLDVTQNPWHCDCSLTYLRLWLEDRTPEALLQVRCASPSLAA
HGPLGRLTGYQLGSCGWQLQASWVRPGVLWDVALVAVAALGLALLAGLLCATTEALD
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcctggggagccctgttcctgctctgggccacagcagaggccaccaaggactgc
cccagcccatgtacctgccgcgccctggaaaccatggggctgtgggtggactgcaggggc
cacggactcacggccctgcctgccctgccggcccgcacccgccaccttctgctggccaac
aacagccttcagtccgtgcccccgggagcctttgaccacctgccccagctgcagaccctc
gatgtgacgcagaacccctggcactgtgactgcagcctcacctatctgcgcctctggctg
gaggaccgcacgcccgaggccctgctgcaggtccgctgtgccagccccagcctcgctgcc
catggcccgctgggccggctgacaggctaccagctgggcagctgtggctggcagctgcag
gcgtcctgggtgcgcccgggggtcttgtgggacgtggcgctggtcgccgtggccgcgctg
ggcctggctcttctggctggcctgctgtgtgccaccacagaggccctggattga

DBGET integrated database retrieval system