KEGG   Homo sapiens (human): 2815Help
Entry
2815              CDS       T01001                                 

Gene name
GP9, CD42a, GPIX
Definition
(RefSeq) glycoprotein IX platelet
  KO
K06263  platelet glycoprotein IX
Organism
hsa  Homo sapiens (human)
Pathway
hsa04512  ECM-receptor interaction
hsa04611  Platelet activation
hsa04640  Hematopoietic cell lineage
Disease
H00224  Bernard-Soulier syndrome
H01740  Macrothrombocytopenia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    2815 (GP9)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    2815 (GP9)
   04611 Platelet activation
    2815 (GP9)
CD molecules [BR:hsa04090]
 Proteins
  2815 (GP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRRNT LRR_8 LRR_4 LRRCT LRR_9
Motif
Other DBs
NCBI-GeneID: 2815
NCBI-ProteinID: NP_000165
OMIM: 173515
HGNC: 4444
Ensembl: ENSG00000169704
Vega: OTTHUMG00000159944
Pharos: P14770(Tbio)
UniProt: P14770
Position
3q21.3
AA seq 177 aa AA seqDB search
MPAWGALFLLWATAEATKDCPSPCTCRALETMGLWVDCRGHGLTALPALPARTRHLLLAN
NSLQSVPPGAFDHLPQLQTLDVTQNPWHCDCSLTYLRLWLEDRTPEALLQVRCASPSLAA
HGPLGRLTGYQLGSCGWQLQASWVRPGVLWDVALVAVAALGLALLAGLLCATTEALD
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcctggggagccctgttcctgctctgggccacagcagaggccaccaaggactgc
cccagcccatgtacctgccgcgccctggaaaccatggggctgtgggtggactgcaggggc
cacggactcacggccctgcctgccctgccggcccgcacccgccaccttctgctggccaac
aacagccttcagtccgtgcccccgggagcctttgaccacctgccccagctgcagaccctc
gatgtgacgcagaacccctggcactgtgactgcagcctcacctatctgcgcctctggctg
gaggaccgcacgcccgaggccctgctgcaggtccgctgtgccagccccagcctcgctgcc
catggcccgctgggccggctgacaggctaccagctgggcagctgtggctggcagctgcag
gcgtcctgggtgcgcccgggggtcttgtgggacgtggcgctggtcgccgtggccgcgctg
ggcctggctcttctggctggcctgctgtgtgccaccacagaggccctggattga

DBGET integrated database retrieval system