KEGG   Homo sapiens (human): 2817Help
Entry
2817              CDS       T01001                                 

Gene name
GPC1, glypican
Definition
(RefSeq) glypican 1
  KO
K08107  
glypican 1
Organism
hsa  Homo sapiens (human)
Pathway
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    2817 (GPC1)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   2817 (GPC1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  2817 (GPC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q35-q37
AA seq 558 aa AA seqDB search
MELRARGWWLLCAAAALVACARGDPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLR
ICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSER
TLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHP
QLLLPDDYLDCLGKQAEALRPFGEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQV
PLGPECSRAVMKLVYCAHCLGVPGARPCPDYCRNVLKGCLANQADLDAEWRNLLDSMVLI
TDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRR
RGKLAPRERPPSGTLEKLVSEAKAQLRDVQDFWISLPGTLCSEKMALSTASDDRCWNGMA
RGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRLRSAYNGNDVDFQD
ASDDGSGSGSGDGCLDDLCSRKVSRKSSSSRTPLTHALPGLSEQEGQKTSAASCPQPPTF
LLPLLLFLALTVARPRWR
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggagctccgggcccgaggctggtggctgctatgtgcggccgcagcgctggtcgcctgc
gcccgcggggacccggccagcaagagccggagctgcggcgaggtccgccagatctacgga
gccaagggcttcagcctgagcgacgtgccccaggcggagatctcgggtgagcacctgcgg
atctgtccccagggctacacctgctgcaccagcgagatggaggagaacctggccaaccgc
agccatgccgagctggagaccgcgctccgggacagcagccgcgtcctgcaggccatgctt
gccacccagctgcgcagcttcgatgaccacttccagcacctgctgaacgactcggagcgg
acgctgcaggccaccttccccggcgccttcggagagctgtacacgcagaacgcgagggcc
ttccgggacctgtactcagagctgcgcctgtactaccgcggtgccaacctgcacctggag
gagacgctggccgagttctgggcccgcctgctcgagcgcctcttcaagcagctgcacccc
cagctgctgctgcctgatgactacctggactgcctgggcaagcaggccgaggcgctgcgg
cccttcggggaggccccgagagagctgcgcctgcgggccacccgtgccttcgtggctgct
cgctcctttgtgcagggcctgggcgtggccagcgacgtggtccggaaagtggctcaggtc
cccctgggcccggagtgctcgagagctgtcatgaagctggtctactgtgctcactgcctg
ggagtccccggcgccaggccctgccctgactattgccgaaatgtgctcaagggctgcctt
gccaaccaggccgacctggacgccgagtggaggaacctcctggactccatggtgctcatc
accgacaagttctggggtacatcgggtgtggagagtgtcatcggcagcgtgcacacgtgg
ctggcggaggccatcaacgccctccaggacaacagggacacgctcacggccaaggtcatc
cagggctgcgggaaccccaaggtcaacccccagggccccgggcctgaggagaagcggcgc
cggggcaagctggccccgcgggagaggccaccttcaggcacgctggagaagctggtctcc
gaagccaaggcccagctccgcgacgtccaggacttctggatcagcctcccagggacactg
tgcagtgagaagatggccctgagcactgccagtgatgaccgctgctggaacgggatggcc
agaggccggtacctccccgaggtcatgggtgacggcctggccaaccagatcaacaacccc
gaggtggaggtggacatcaccaagccggacatgaccatccggcagcagatcatgcagctg
aagatcatgaccaaccggctgcgcagcgcctacaacggcaacgacgtggacttccaggac
gccagtgacgacggcagcggctcgggcagcggtgatggctgtctggatgacctctgcagc
cggaaggtcagcaggaagagctccagctcccggacgcccttgacccatgccctcccaggc
ctgtcagagcaggaaggacagaagacctcggctgccagctgcccccagcccccgaccttc
ctcctgcccctcctcctcttcctggcccttacagtagccaggccccggtggcggtaa

DBGET integrated database retrieval system