KEGG   Homo sapiens (human): 2826Help
Entry
2826              CDS       T01001                                 

Gene name
CCR10, GPR2
Definition
chemokine (C-C motif) receptor 10
Orthology
K04185  
C-C chemokine receptor type 10
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Intestinal immune network for IgA production
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Intestinal immune network for IgA production [PATH:hsa04672]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
17q21.1-q21.3
AA seq 362 aa AA seqDB search
MGTEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQPSVSLTVAALGLAGNG
LVLATHLAARRAARSPTSAHLLQLALADLLLALTLPFAAAGALQGWSLGSATCRTISGLY
SASFHAGFLFLACISADRYVAIARALPAGPRPSTPGRAHLVSVIVWLLSLLLALPALLFS
QDGQREGQRRCRLIFPEGLTQTVKGASAVAQVALGFALPLGVMVACYALLGRTLLAARGP
ERRRALRVVVALVAAFVVLQLPYSLALLLDTADLLAARERSCPASKRKDVALLVTSGLAL
ARCGLNPVLYAFLGLRFRQDLRRLLRGGSCPSGPQPRRGCPRRPRLSSCSAPTETHSLSW
DN
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggggacggaggccacagagcaggtttcctggggccattactctggggatgaagaggac
gcatactcggctgagccactgccggagctttgctacaaggccgatgtccaggccttcagc
cgggccttccaacccagtgtctccctgaccgtggctgcgctgggtctggccggcaatggc
ctggtcctggccacccacctggcagcccgacgcgcagcgcgctcgcccacctctgcccac
ctgctccagctggccctggccgacctcttgctggccctgactctgcccttcgcggcagca
ggggctcttcagggctggagtctgggaagtgccacctgccgcaccatctctggcctctac
tcggcctccttccacgccggcttcctcttcctggcctgtatcagcgccgaccgctacgtg
gccatcgcgcgagcgctcccagccgggccgcggccctccactcccggccgcgcacacttg
gtctccgtcatcgtgtggctgctgtcactgctcctggcgctgcctgcgctgctcttcagc
caggatgggcagcgggaaggccaacgacgctgtcgcctcatcttccccgagggcctcacg
cagacggtgaagggggcgagcgccgtggcgcaggtggccctgggcttcgcgctgccgctg
ggcgtcatggtagcctgctacgcgcttctgggccgcacgctgctggccgccagggggccc
gagcgccggcgtgcgctgcgcgtcgtggtggctctggtggcggccttcgtggtgctgcag
ctgccctacagcctcgccctgctgctggatactgccgatctactggctgcgcgcgagcgg
agctgccctgccagcaaacgcaaggatgtcgcactgctggtgaccagcggcttggccctc
gcccgctgtggcctcaatcccgttctctacgccttcctgggcctgcgcttccgccaggac
ctgcggaggctgctacggggtgggagctgcccctcagggcctcaaccccgccgcggctgc
ccccgccggccccgcctttcttcctgctcagctcccacggagacccacagtctctcctgg
gacaactag

DBGET integrated database retrieval system