KEGG   Homo sapiens (human): 282616Help
Entry
282616            CDS       T01001                                 

Gene name
IFNL2, IL-28A, IL28A
Definition
interferon, lambda 2
Orthology
K05447  
interleukin 28/29 (interferon, lambda)
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.13
AA seq 200 aa AA seqDB search
MKLDMTGDCTPVLVLMAAVLTVTGAVPVARLHGALPDARGCHIAQFKSLSPQELQAFKRA
KDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALV
DVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTF
NLFRLLTRDLNCVASGDLCV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaactagacatgactggggactgcacgccagtgctggtgctgatggccgcagtgctg
accgtgactggagcagttcctgtcgccaggctccacggggctctcccggatgcaaggggc
tgccacatagcccagttcaagtccctgtctccacaggagctgcaggcctttaagagggcc
aaagatgccttagaagagtcgcttctgctgaaggactgcaggtgccactcccgcctcttc
cccaggacctgggacctgaggcagctgcaggtgagggagcgccccatggctttggaggct
gagctggccctgacgctgaaggttctggaggccaccgctgacactgacccagccctggtg
gacgtcttggaccagccccttcacaccctgcaccatatcctctcccagttccgggcctgt
atccagcctcagcccacggcagggcccaggacccggggccgcctccaccattggctgtac
cggctccaggaggccccaaaaaaggagtcccctggctgcctcgaggcctctgtcaccttc
aacctcttccgcctcctcacgcgagacctgaattgtgttgccagtggggacctgtgtgtc
tga

DBGET integrated database retrieval system