KEGG   Homo sapiens (human): 282618Help
Entry
282618            CDS       T01001                                 

Gene name
IFNL1, IL-29, IL29
Definition
interferon, lambda 1
Orthology
K05447  
interleukin 28/29 (interferon, lambda)
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    282618 (IFNL1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    282618 (IFNL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.13
AA seq 200 aa AA seqDB search
MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEES
LKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHT
LHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRD
LKYVADGNLCLRTSTHPEST
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagcttggaccgtggtgctggtgactttggtgctaggcttggccgtggcaggc
cctgtccccacttccaagcccaccacaactgggaagggctgccacattggcaggttcaaa
tctctgtcaccacaggagctagcgagcttcaagaaggccagggacgccttggaagagtca
ctcaagctgaaaaactggagttgcagctctcctgtcttccccgggaattgggacctgagg
cttctccaggtgagggagcgccctgtggccttggaggctgagctggccctgacgctgaag
gtcctggaggccgctgctggcccagccctggaggacgtcctagaccagccccttcacacc
ctgcaccacatcctctcccagctccaggcctgtatccagcctcagcccacagcagggccc
aggccccggggccgcctccaccactggctgcaccggctccaggaggcccccaaaaaggag
tccgctggctgcctggaggcatctgtcaccttcaacctcttccgcctcctcacgcgagac
ctcaaatatgtggccgatgggaacctgtgtctgagaacgtcaacccaccctgagtccacc
tga

DBGET integrated database retrieval system