KEGG   Homo sapiens (human): 2827Help
Entry
2827              CDS       T01001                                 

Gene name
GPR3, ACCA
Definition
(RefSeq) G protein-coupled receptor 3
  KO
K04311  
G protein-coupled receptor 3
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Other
   GPR
    2827 (GPR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.1-p35
AA seq 330 aa AA seqDB search
MMWGAGSPLAWLSAGSGNVNVSSVGPAEGPTGPAAPLPSPKAWDVVLCISGTLVSCENAL
VVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAAVFCIGSAEMSLVLVGVLAMAF
TASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCLDG
LTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCRHAQQIALQRHLLPASHYV
ATRKGIATLAVVLGAFAACWLPFTVYCLLGDAHSPPLYTYLTLLPATYNSMINPIIYAFR
NQDVQKVLWAVCCCCSSSKIPFRSRSPSDV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggggtgcaggcagccctctggcctggctctcagctggctcaggcaacgtgaat
gtaagcagcgtgggcccagcagaggggcccacaggtccagccgcaccactgccctcgcct
aaggcctgggatgtggtgctctgcatctcaggcaccctggtgtcctgcgagaatgcgcta
gtggtggccatcatcgtgggcactcctgccttccgtgcccccatgttcctgctggtgggc
agcctggccgtggcagacctgctggcaggcctgggcctggtcctgcactttgctgctgtc
ttctgcatcggctcagcggagatgagcctggtgctggttggcgtgctggcaatggccttt
accgccagcatcggcagtctactggccatcactgtcgaccgctacctttctctgtacaat
gccctcacctactattcagagacaacagtgacacggacctatgtgatgctggccttagtg
tggggaggtgccctgggcctggggctgctgcctgtgctggcctggaactgcctggatggc
ctgaccacatgtggcgtggtttatccactctccaagaaccatctggtagttctggccatt
gccttcttcatggtgtttggcatcatgctgcagctctacgcccaaatctgccgcatcgtc
tgccgccatgcccagcagattgcccttcagcggcacctgctgcctgcctcccactatgtg
gccacccgcaagggcattgccacactggccgtggtgcttggagcctttgccgcctgctgg
ttgcccttcactgtctactgcctgctgggtgatgcccactctccacctctctacacctat
cttaccttgctccctgccacctacaactccatgatcaaccctatcatctacgccttccgc
aaccaggatgtgcagaaagtgctgtgggctgtctgctgctgctgttcctcttccaagatc
cccttccgatcccgctcccccagtgatgtctag

DBGET integrated database retrieval system