KEGG   Homo sapiens (human): 282770Help
Entry
282770            CDS       T01001                                 

Gene name
OR10AG1, OR11-160
Definition
(RefSeq) olfactory receptor family 10 subfamily AG member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    282770 (OR10AG1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    282770 (OR10AG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 Herpes_env
Motif
Other DBs
NCBI-GeneID: 282770
NCBI-ProteinID: NP_001005491
HGNC: 19607
Ensembl: ENSG00000174970
Vega: OTTHUMG00000166824
Pharos: Q8NH19(Tdark)
UniProt: Q8NH19 A0A126GVM8
Position
11q12.1
AA seq 301 aa AA seqDB search
MEFVLLGFSDIPNLHWMLFSIFLLMYLMILMCNGIIILLIKIHPALQTPMYFFLSNFSLL
EICYVTIIIPRMLMDIWTQKGNISLFACATQMCFFLMLGGTECLLLTVMAYDRYVAICKP
LQYPLVMNHKVCIQLIIASWTITIPVVIGETCQIFLLPFCGTNTINHFFCDIPPILKLAC
GNIFVNEITVHVVAVVFITVPFLLIVVSYGKIISNILKLSSARGKAKAFSTCSSHLIVVI
LFFGAGTITYLQPKPHQFQRMGKLISLFYTILIPTLNPIIYTLRNKDIMVALRKLLAKLL
T
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaatttgttcttttggggttttctgatattcccaatctccactggatgctttttagt
atatttttacttatgtatttgatgatcctgatgtgcaatggcatcataatactactaata
aaaattcaccccgctctccagactcccatgtatttttttcttagcaatttttcccttttg
gaaatctgttatgtaacaatcattatcccaagaatgctcatggacatttggactcagaaa
ggaaatatttctttgtttgcttgtgctacacaaatgtgtttttttcttatgcttggaggc
acggagtgtctccttctgacagtgatggcctatgaccgctacgtggctatttgtaagcct
ttgcagtatcctctagtgatgaaccacaaagtctgcattcagctgataatagcttcctgg
accatcacaattcctgtagtaattggggaaacatgccaaattttccttttgcccttttgc
ggaactaacacaattaatcatttcttttgtgacatcccgccaatactcaagcttgcttgt
ggaaacatatttgtgaatgagataacagtccatgtagtagcggtggtgtttatcacggtg
ccatttctgttgattgttgtctcttatggcaaaattatctccaacattttgaaattgtca
tcagccagaggaaaggctaaagccttctccacctgctcatctcacctaatagttgtaatc
ttattctttggagcaggtactatcacttatttacagcccaaaccacatcagtttcaaagg
atggggaaactgatttctcttttctacaccattctgattccaactttgaatcctattata
tataccctgaggaacaaagatatcatggtggcattgagaaaattactagctaagttatta
acatga

DBGET integrated database retrieval system