KEGG   Homo sapiens (human): 282775Help
Entry
282775            CDS       T01001                                 

Gene name
OR5J2, OR11-266
Definition
(RefSeq) olfactory receptor family 5 subfamily J member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    282775 (OR5J2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    282775 (OR5J2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 282775
NCBI-ProteinID: NP_001005492
HGNC: 19612
Ensembl: ENSG00000174957
Vega: OTTHUMG00000166835
Pharos: Q8NH18(Tdark)
UniProt: Q8NH18 A0A126GVP0
Position
11q12.1
AA seq 312 aa AA seqDB search
MADDNFTVVTEFILLGLTDHAELKAVLFVVFLVIYAITLLRNLGMILLIQITSKLHTPMY
FLLSCLSFVDACYSSAIAPKMLVNLLVVKATISFSACMVQHLCFGVFITTEGFLLSVMAY
DRYVAIVSPLLYTVAMSDRKCVELVTGSWIGGIVNTLIHTISLRRLSFCRLNAVSHFFCD
IPSLLKLSCSDTSMNELLLLTFSGVIAMATFLTVIISYIFIAFASLRIHSASGRQQAFST
CASHLTAVTIFYGTLIFSYIQPSSQYFVEQEKVVSMFYTLGIPMLNLLIHSLRNKDVKEA
VKRAIEMKHFLC
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgataattttacagttgtcactgagtttattcttttgggattgacagatcat
gctgaactaaaagctgtgctttttgtggtgttcctggtgatttacgccattaccttgttg
aggaatctgggcatgatcctcttaatccaaatcacctccaaactccacacacccatgtac
tttttactcagctgtctttcatttgtggatgcctgctattcatctgcaattgcacccaaa
atgctggtgaacctcctggttgtgaaggcaacaatttctttctctgcttgcatggtacag
catttgtgtttcggagtgttcatcaccacagaaggcttcttactgtcagtgatggcctat
gaccgctatgtggccattgtgagtcccttgctttacactgtagccatgtctgatagaaag
tgtgtggagcttgtcacaggatcatggataggtggaatagttaacacattaatccacaca
atcagcttgaggagactgtccttttgtaggctaaatgctgtcagccacttcttctgtgac
attccttcactgctaaagctgtcatgttctgacacctccatgaatgagttgttgctgtta
accttctccggagtcattgccatggccaccttcttgactgtgatcatttcctacatcttc
attgcttttgctagcctaaggatccactcagcatcaggcagacagcaagccttctccacc
tgtgcctctcacctgactgctgtgaccatattctatggtaccttaatctttagctacatt
cagccaagctcccagtattttgtggaacaagagaaagtggtttctatgttctatacgcta
gggattcccatgttaaacctgttgatacacagtttgagaaacaaggacgtaaaggaggca
gtgaaaagggccatagaaatgaaacatttcctctgttaa

DBGET integrated database retrieval system