KEGG   Homo sapiens (human): 2829Help
Entry
2829              CDS       T01001                                 

Gene name
XCR1, CCXCR1, GPR5
Definition
chemokine (C motif) receptor 1
Orthology
K04193  
XC chemokine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Disease
H01360  
Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2829 (XCR1)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    2829 (XCR1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   C Chemokine
    2829 (XCR1)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  C Chemokine
   2829 (XCR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
3p21.3
AA seq 333 aa AA seqDB search
MESSGNPESTTFFYYDLQSQPCENQAWVFATLATTVLYCLVFLLSLVGNSLVLWVLVKYE
SLESLTNIFILNLCLSDLVFACLLPVWISPYHWGWVLGDFLCKLLNMIFSISLYSSIFFL
TIMTIHRYLSVVSPLSTLRVPTLRCRVLVTMAVWVASILSSILDTIFHKVLSSGCDYSEL
TWYLTSVYQHNLFFLLSLGIILFCYVEILRTLFRSRSKRRHRTVKLIFAIVVAYFLSWGP
YNFTLFLQTLFRTQIIRSCEAKQQLEYALLICRNLAFSHCCFNPVLYVFVGVKFRTHLKH
VLRQFWFCRLQAPSPASIPHSPGAFAYEGASFY
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggagtcctcaggcaacccagagagcaccacctttttttactatgaccttcagagccag
ccgtgtgagaaccaggcctgggtctttgctaccctcgccaccactgtcctatactgcctg
gtgtttctcctcagcctagtgggcaacagcctggtcctgtgggtcctggtgaagtatgag
agcctggagtccctcaccaacatcttcatcctcaacctgtgcctctcagacctggtgttc
gcctgcttgttgcctgtgtggatctccccataccactggggctgggtgctgggagacttc
ctctgcaaactcctcaatatgatcttctccatcagcctctacagcagcatcttcttcctg
accatcatgaccatccaccgctacctgtcggtagtgagccccctctccaccctgcgcgtc
cccaccctccgctgccgggtgctggtgaccatggctgtgtgggtagccagcatcctgtcc
tccatcctcgacaccatcttccacaaggtgctttcttcgggctgtgattattccgaactc
acgtggtacctcacctccgtctaccagcacaacctcttcttcctgctgtccctggggatt
atcctgttctgctacgtggagatcctcaggaccctgttccgctcacgctccaagcggcgc
caccgcacggtcaagctcatcttcgccatcgtggtggcctacttcctcagctggggtccc
tacaacttcaccctgtttctgcagacgctgtttcggacccagatcatccggagctgcgag
gccaaacagcagctagaatacgccctgctcatctgccgcaacctcgccttctcccactgc
tgctttaacccggtgctctatgtcttcgtgggggtcaagttccgcacacacctgaaacat
gttctccggcagttctggttctgccggctgcaggcacccagcccagcctcgatcccccac
tcccctggtgccttcgcctatgagggcgcctccttctactga

DBGET integrated database retrieval system