KEGG   Homo sapiens (human): 283Help
Entry
283               CDS       T01001                                 

Gene name
ANG, ALS9, HEL168, RAA1, RNASE4, RNASE5
Definition
(RefSeq) angiogenin (EC:3.1.27.-)
  KO
K16631  
angiogenin [EC:3.1.27.-]
Organism
hsa  Homo sapiens (human)
Disease
H00058  
Amyotrophic lateral sclerosis (ALS)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.-  
     283 (ANG)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  tRNA degradation factors
   Other tRNA degradation factors
    283 (ANG)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Others
   283 (ANG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q11.1-q11.2
AA seq 147 aa AA seqDB search
MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLT
SPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRA
TAGFRNVVVACENGLPVHLDQSIFRRP
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgggcctgggcgttttgttgttggtcttcgtgctgggtctgggtctgacccca
ccgaccctggctcaggataactccaggtacacacacttcctgacccagcactatgatgcc
aaaccacagggccgggatgacagatactgtgaaagcatcatgaggagacggggcctgacc
tcaccctgcaaagacatcaacacatttattcatggcaacaagcgcagcatcaaggccatc
tgtgaaaacaagaatggaaaccctcacagagaaaacctaagaataagcaagtcttctttc
caggtcaccacttgcaagctacatggaggttccccctggcctccatgccagtaccgagcc
acagcggggttcagaaacgttgttgttgcttgtgaaaatggcttacctgtccacttggat
cagtcaattttccgtcgtccgtaa

DBGET integrated database retrieval system