KEGG   Homo sapiens (human): 283092Help
Entry
283092            CDS       T01001                                 

Gene name
OR4C13
Definition
olfactory receptor, family 4, subfamily C, member 13
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    283092 (OR4C13)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    283092 (OR4C13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p11.12
AA seq 309 aa AA seqDB search
MANRNNVTEFILLGLTENPKMQKIIFVVFSVIYINAMIGNVLIVVTITASPSLRSPMYFF
LAYLSFIDACYSSVNTPKLITDSLYENKTILFNGCMTQVFGEHFFRGVEVILLTVMAYDH
YVAICKPLHYTTVMKQHVCSLLVGVSWVGGFLHATIQILFICQLPFCGPNVIDHFMCDLY
TLINLACTNTHTLGLFIAANSGFICLLNCLLLLVSCVVILYSLKTHSLEARHEALSTCVS
HITVVILSFIPCIFVYMRPPATLPIDKAVAVFYTMITSMLNPLIYTLRNAQMKNAIRKLC
SRKAISSVK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatagaaacaatgtgacagagtttattctattggggcttacagagaatccaaaa
atgcagaaaatcatatttgttgtgttttctgtcatctacatcaacgccatgataggaaat
gtgctcattgtggtcaccatcactgccagcccatcactgagatcccccatgtactttttc
ctggcctatctctcctttattgatgcctgctattcctctgtcaatacccctaagctgatc
acagattcactctatgaaaacaagactatcttattcaatggatgtatgactcaagtcttt
ggagaacattttttcagaggtgttgaggtcatcctacttactgtaatggcctatgaccac
tatgtggccatctgcaagcccttgcactataccaccgtcatgaagcagcatgtttgtagc
ctgctagtgggagtgtcatgggtaggaggctttcttcatgcaaccatacagatcctcttc
atctgtcaattacctttctgtggtcctaatgtcatagatcactttatgtgtgatctctac
actttgatcaatcttgcctgcactaatacccacactctaggactcttcattgctgccaac
agtgggttcatatgcctgttaaactgtctcttgctcctggtctcctgcgtggtcatactg
tactccttaaagacccacagcttagaggcaaggcacgaagccctctctacctgtgtctcc
cacatcacagttgtcatcttatcctttataccctgcatatttgtgtacatgagacctcca
gctactttacccattgataaagcagttgctgtattctacactatgataacttctatgtta
aaccccttaatctacaccttgaggaatgctcaaatgaaaaatgccattaggaaattgtgt
agtaggaaagctatttcaagtgtcaaataa

DBGET integrated database retrieval system