KEGG   Homo sapiens (human): 283093Help
Entry
283093            CDS       T01001                                 

Gene name
OR4C12, OR11-259
Definition
(RefSeq) olfactory receptor family 4 subfamily C member 12
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    283093 (OR4C12)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    283093 (OR4C12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 283093
NCBI-ProteinID: NP_001005270
HGNC: 15168
Ensembl: ENSG00000221954
Vega: OTTHUMG00000166687
Pharos: Q96R67(Tdark)
UniProt: Q96R67
Position
11p11.12
AA seq 309 aa AA seqDB search
MEKKKNVTEFILIGLTQNPIMEKVTFVVFLVLYMITLSGNLLIVVTITTSQALSSPMYFF
LTHLSLIDTVYSSSSAPKLIVDSFQEKKIISFNGCMAQAYAEHIFGATEIILLTVMACDC
YVAICKPLNYTTIMSHSLCILLVAVAWVGGFLHATIQILFTVWLPFCGPNVIGHFMCDLY
PLLKLVCIDTHTLGLFVAVNSGFICLLNFLILVVSYVIILRSLKNNSLEGRCKALSTCIS
HIIVVVLFFVPCIFVYLRSVTTLPIDKAVAVFYTMVVPMLNPVVYTLRNAEVKSAIRKLW
RKKVTSDND
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaaaaagaatgtgactgaattcattttaataggtcttacacagaaccccata
atggagaaagtcacgtttgtagtatttttggttctttacatgataacactttcaggcaac
ctgctcattgtggttaccattaccaccagccaggctctgagctcccccatgtacttcttc
ctgacccacctttctttgatagacacagtttattcttcttcttcagctcctaagttgatt
gtggattcctttcaagagaagaaaatcatctcctttaatgggtgtatggctcaagcctat
gcagaacacatttttggtgctactgagatcatcctgctgacagtgatggcctgtgactgc
tatgtggccatctgcaaacctctgaactacacaaccattatgagccacagcctgtgcatt
ctcctggtggcagtggcctgggtgggaggatttcttcatgcaactattcagattctcttt
acagtatggctgcccttctgtggccccaatgtcataggccacttcatgtgtgacttgtac
ccattgttaaaacttgtttgcatagacactcatacccttggtctctttgttgctgtgaac
agtgggtttatctgcttattaaacttccttatcttggtggtatcctatgtgatcatcttg
agatctttaaagaacaatagcttggaggggaggtgtaaagccctctccacctgtatttct
cacatcatagtagttgtcttattctttgtgccctgtatatttgtgtatctgcgctcagtg
accactctgcccattgataaagctgttgctgtattttatactatggtggtcccaatgtta
aatcccgtggtctacacactcagaaatgctgaggtaaaaagtgcaataaggaagctttgg
agaaaaaaagtgacttcagataatgattaa

DBGET integrated database retrieval system