KEGG   Homo sapiens (human): 283111Help
Entry
283111            CDS       T01001                                 

Gene name
OR51V1, OR11-36, OR51A12
Definition
(RefSeq) olfactory receptor family 51 subfamily V member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    283111 (OR51V1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    283111 (OR51V1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 283111
NCBI-ProteinID: NP_001004760
HGNC: 19597
Ensembl: ENSG00000176742
Vega: OTTHUMG00000066671
Pharos: Q9H2C8(Tdark)
UniProt: Q9H2C8
Position
11p15.4
AA seq 321 aa AA seqDB search
MFLSSRMITSVSPSTSTNSSFLLTGFSGMEQQYPWLSIPFSSIYAMVLLGNCMVLHVIWT
EPSLHQPMFYFLSMLALTDLCMGLSTVYTVLGILWGIIREISLDSCIAQSYFIHGLSFME
SSVLLTMAFDRYIAICNPLRYSSILTNSRIIKIGLTIIGRSFFFITPPIICLKFFNYCHF
HILSHSFCLHQDLLRLACSDIRFNSYYALMLVICILLLDAILILFSYILILKSVLAVASQ
EERHKLFQTCISHICAVLVFYIPIISLTMVHRFGKHLSPVAHVLIGNIYILFPPLMNPII
YSVKTQQIHTRMLRLFSLKRY
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcagttccagaatgattacttcagtaagccctagcaccagcacgaattcttcc
tttcttctcactggattttctggcatggagcagcaatacccctggctttccatccccttc
tcctcaatctatgccatggtgcttttgggcaattgcatggttctccatgtgatatggact
gagccaagcctgcaccagcctatgttttacttcctgtccatgctggccctcactgacctg
tgcatggggctgtccactgtgtacacagtgctggggatcctgtgggggatcattcgagag
atcagcttggattcctgcattgcccagtcctatttcatccatggtctgtccttcatggag
tcctctgtcctcctcactatggcctttgaccggtacattgcaatttgcaatccactacgt
tattcctccatcctgactaattccagaattatcaaaattgggctcactataataggtagg
agttttttctttattacaccccccatcatctgtctgaaattttttaattactgtcatttc
cacatcctttctcactctttctgcctgcaccaggatcttctccgcttagcctgttcagac
atccgattcaatagttactatgccctgatgctggttatttgcatactgttgttggatgct
atactcatccttttctcctacatcctgattcttaagtcagtcctggcagttgcctctcag
gaagagaggcataaattatttcagacctgcatctcccacatctgtgctgtccttgtgttc
tacatccctatcattagcctcacaatggtgcaccgttttggcaagcacctttcccccgtg
gcccacgttctcattggcaacatctacatccttttcccacctttaatgaatcccatcatc
tacagtgtcaagacccaacagattcataccagaatgcttagactcttttctctgaaaaga
tattga

DBGET integrated database retrieval system