KEGG   Homo sapiens (human): 283159Help
Entry
283159            CDS       T01001                                 

Gene name
OR8D1, JCG9, OR8D3, OST004, PDJ9J14
Definition
olfactory receptor, family 8, subfamily D, member 1
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    283159 (OR8D1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    283159 (OR8D1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q24.2
AA seq 308 aa AA seqDB search
MTMENYSMAAQFVLDGLTQQAELQLPLFLLFLGIYVVTVVGNLGMILLIAVSPLLHTPMY
YFLSSLSFVDFCYSSVITPKMLVNFLGKKNTILYSECMVQLFFFVVFVVAEGYLLTAMAY
DRYVAICSPLLYNAIMSSWVCSLLVLAAFFLGFLSALTHTSAMMKLSFCKSHIINHYFCD
VLPLLNLSCSNTHLNELLLFIIAGFNTLVPTLAVAVSYAFILYSILHIRSSEGRSKAFGT
CSSHLMAVVIFFGSITFMYFKPPSSNSLDQEKVSSVFYTTVIPMLNPLIYSLRNKDVKKA
LRKVLVGK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggaaaattattctatggcagctcagtttgtcttagatggtttaacacagcaa
gcagagctccagctgcccctcttcctcctgttcctgggaatctatgtggtcacagtagtg
ggcaacctgggcatgattctcctgattgcagtcagccctctacttcacacccccatgtac
tatttcctcagcagcttgtccttcgtcgatttctgctattcctctgtcattactcccaaa
atgctggtgaacttcctaggaaagaagaatacaatcctttactctgagtgcatggtccag
ctctttttctttgtggtctttgtggtggctgagggttacctcctgactgccatggcatat
gatcgctatgttgccatctgtagcccactgctttataatgcgatcatgtcctcatgggtc
tgctcactgctagtgctggctgccttcttcttgggctttctctctgccttgactcataca
agtgccatgatgaaactgtccttttgcaaatcccacattatcaaccattacttctgtgat
gttcttcccctcctcaatctctcctgctccaacacacacctcaatgagcttctacttttt
atcattgcggggtttaacaccttggtgcccaccctagctgttgctgtctcctatgccttc
atcctctacagcatccttcacatccgctcctcagagggccggtccaaagcttttggaaca
tgcagctctcatctcatggctgtggtgatcttctttgggtccattaccttcatgtatttc
aagcccccttcaagtaactccctggaccaggagaaggtgtcctctgtgttctacaccacg
gtgatccccatgctgaaccctttaatatacagtctgaggaataaggatgtgaagaaagca
ttaaggaaggtcttagtaggaaaatga

DBGET integrated database retrieval system