KEGG   Homo sapiens (human): 283297Help
Entry
283297            CDS       T01001                                 

Gene name
OR10A4, JCG5, OR10A4P
Definition
(RefSeq) olfactory receptor family 10 subfamily A member 4
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    283297 (OR10A4)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    283297 (OR10A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 SLC3A2_N
Motif
Other DBs
NCBI-GeneID: 283297
NCBI-ProteinID: NP_997069
HGNC: 15130
Ensembl: ENSG00000170782
Vega: OTTHUMG00000165740
Pharos: Q9H209(Tbio)
UniProt: Q9H209
Position
11p15.4
AA seq 315 aa AA seqDB search
MMWENWTIVSEFVLVSFSALSTELQALLFLLFLTIYLVTLMGNVLIILVTIADSALQSPM
YFFLRNLSFLEIGFNLVIVPKMLGTLIIQDTTISFLGCATQMYFFFFFGAAECCLLATMA
YDRYVAICDPLHYPVIMGHISCAQLAAASWFSGFSVATVQTTWIFSFPFCGPNRVNHFFC
DSPPVIALVCADTSVFELEALTATVLFILFPFLLILGSYVRILSTIFRMPSAEGKHQAFS
TCSAHLLVVSLFYSTAILTYFRPQSSASSESKKLLSLSSTVVTPMLNPIIYSSRNKEVKA
ALKRLIHRTLGSQKL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgatgtgggaaaactggacaattgtcagtgaatttgttctcgtgagcttctcagccctg
tccactgagcttcaggctctactgtttctccttttcttgaccatttacttggttacttta
atgggcaatgtcctcatcatcctggtcactatagctgactctgcactacaaagtcctatg
tacttcttcctcagaaacttgtccttcctggagataggtttcaacttggtcattgtgccc
aagatgctggggaccctgatcattcaagacacaaccatctccttccttggatgtgccact
cagatgtatttcttcttcttttttggggctgctgagtgctgcctcctggccaccatggca
tatgaccgctacgtggccatctgtgaccccttgcactacccagtcatcatgggccacata
tcctgtgcccagctggcagctgcctcttggttctcagggttttcagtggccactgtgcaa
accacatggattttcagtttccctttttgtggccccaacagggtgaaccacttcttctgt
gacagccctcctgttattgcactggtctgtgctgacacctctgtgtttgaactggaggct
ctgacagccactgtcctattcattctctttcctttcttgctgatcctgggatcctatgtc
cgcatcctctccactatcttcaggatgccgtcagctgaggggaaacatcaggcattctcc
acctgttccgcccacctcttggttgtctctctcttctatagcactgccatcctcacgtat
ttccgaccccaatccagtgcctcttctgagagcaagaagctgctgtcactctcttccaca
gtggtgactcccatgttgaaccccatcatctacagctcaaggaataaagaagtgaaggct
gcactgaagcggcttatccacaggaccctgggctctcagaaactatga

DBGET integrated database retrieval system