KEGG   Homo sapiens (human): 283365Help
Entry
283365            CDS       T01001                                 

Gene name
OR6C6
Definition
(RefSeq) olfactory receptor family 6 subfamily C member 6
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    283365 (OR6C6)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    283365 (OR6C6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 283365
NCBI-ProteinID: NP_001005493
HGNC: 31293
Ensembl: ENSG00000188324
Vega: OTTHUMG00000168101
Pharos: A6NF89(Tdark)
UniProt: A6NF89 A0A126GW15
Position
12q13.2
AA seq 314 aa AA seqDB search
MKNKSMEIEFILLGLTDDPQLQIVIFLFLFLNYTLSLMGNLIIIILTLLDPRLKTPMYFF
LRNFSFLEVIFTTVCIPRFLITIVTRDKTISYNNCATQLFFILLPGVTEFYLLAAMSYDR
YVAICKPLHYPIIMSSKVCYQLVLSSWVTGFLIIFPPLVMGLKLDFCASKTIDHFMCETS
PILQISCTDTHVLELMSFTLAVVTLVVTLVLVILSYTCIIKTILKFSSAQQRNKAFSTCT
SHMIVVSMTYGSCIFMYIKPSAKERVTVSKGVALLYTSIAPLLNPFIYTLRNQQVKEVFW
DVLQKNLCFSKRPF
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacaaatcaatggaaatagagttcattctcctaggattgacagatgacccacag
ttgcaaattgtgattttcctgtttctatttctcaactacaccttgagcctgatggggaac
ttaatcatcatcatcctcaccctgctggatccccggctcaagacgccaatgtatttcttt
ctccgtaatttctcctttttggaagtaatattcacaacagtgtgtattcctagattcttg
ataaccattgtgactagagacaaaaccatttcttataataattgtgcaactcaattattt
tttatccttttaccgggagttactgagttttacctcctggctgccatgtcctatgaccgc
tacgttgccatctgcaaaccactgcattatccaatcattatgagcagcaaagtctgctac
caacttgtacttagctcttgggtaactggattcttaatcatatttcccccattggtcatg
ggactcaagctggatttttgtgcttccaaaactattgaccactttatgtgtgaaacttct
cctattctgcagatctcctgcacagatacccatgtcctagaattgatgtcttttacctta
gctgtggtgacacttgtggtcacactggtattagtgattctctcttacacttgcattatt
aagaccattctgaaattctcttctgcacagcaaaggaacaaagcattttccacctgtact
tcccacatgattgttgtctccatgacatacggtagctgtatctttatgtatattaaacca
tctgcaaaagaaagagtgactgtatccaaaggtgtagctttgctctatacctcaattgcc
cctttactaaatcccttcatttatactctcagaaaccagcaggtgaaagaagtcttctgg
gatgtattacaaaagaatttgtgtttttctaaaagaccattttaa

DBGET integrated database retrieval system