KEGG   Homo sapiens (human): 2837Help
Entry
2837              CDS       T01001                                 

Gene name
UTS2R, GPR14, UR-2-R, UTR, UTR2
Definition
urotensin 2 receptor
Orthology
K04241  
urotensin 2 receptor
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2837 (UTS2R)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Cardiovascular peptide
   Urotensin II
    2837 (UTS2R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25.3
AA seq 389 aa AA seqDB search
MALTPESPSSFPGLAATGSSVPEPPGGPNATLNSSWASPTEPSSLEDLVATGTIGTLLSA
MGVVGVVGNAYTLVVTCRSLRAVASMYVYVVNLALADLLYLLSIPFIVATYVTKEWHFGD
VGCRVLFGLDFLTMHASIFTLTVMSSERYAAVLRPLDTVQRPKGYRKLLALGTWLLALLL
TLPVMLAMRLVRRGPKSLCLPAWGPRAHRAYLTLLFATSIAGPGLLIGLLYARLARAYRR
SQRASFKRARRPGARALRLVLGIVLLFWACFLPFWLWQLLAQYHQAPLAPRTARIVNYLT
TCLTYGNSCANPFLYTLLTRNYRDHLRGRVRGPGSGGGRGPVPSLQPRARFQRCSGRSLS
SCSPQPTDSLVLAPAAPARPAPEGPRAPA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgacccccgagtccccgagcagcttccctgggctggccgccaccggcagctct
gtgccggagccgcctggcggccccaacgcaaccctcaacagctcctgggccagcccgacc
gagcccagctccctggaggacctggtggccacgggcaccattgggactctgctgtcggcc
atgggcgtggtgggcgtggtgggcaacgcctacacgctggtggtcacctgccgctccctg
cgtgcggtggcctccatgtacgtctacgtggtcaacctggcgctggccgacctgctgtac
ctgctcagcatccccttcatcgtggccacctacgtcaccaaggagtggcacttcggggac
gtgggctgccgcgtgctcttcggcctggacttcctgaccatgcacgccagcatcttcacg
ctgaccgtcatgagcagcgagcgctacgctgcggtgctgcggccgctggacaccgtgcag
cgccccaagggctaccgcaagctgctggcgctgggcacctggctgctggcgctgctgctg
acgctgcccgtgatgctggccatgcggctggtgcgccggggtcccaagagcctgtgcctg
cccgcctggggcccgcgcgcccaccgcgcctacctgacgctgctcttcgccaccagcatc
gcggggcccgggctgctcatcgggctgctctacgcgcgcctggcccgcgcctaccgccgc
tcgcagcgcgcctccttcaagcgggcccggcggccgggggcgcgcgcgctgcgcctggtg
ctgggcatcgtgctgctcttctgggcctgcttcctgcccttctggctgtggcagctgctc
gcccagtaccaccaggccccgctggcgccgcggacggcgcgcatcgtcaactacctgacc
acctgcctcacctacggcaacagctgcgccaaccccttcctctacacgctgctcaccagg
aactaccgcgaccacctgcgcggccgcgtgcggggcccgggcagcgggggaggccggggg
cccgttccctccctgcagccccgcgcccgcttccagcgctgttcgggccgctccctgtct
tcctgcagcccacagcccactgacagcctcgtgctggccccagcggccccggcccgacct
gcgcccgagggtcccagggccccggcgtga

DBGET integrated database retrieval system