KEGG   Homo sapiens (human): 284Help
Entry
284               CDS       T01001                                 

Gene name
ANGPT1, AGP1, AGPT, ANG1
Definition
angiopoietin 1
Orthology
K05465  
angiopoietin 1
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Rheumatoid arthritis
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    284 (ANGPT1)
   04015 Rap1 signaling pathway
    284 (ANGPT1)
   04066 HIF-1 signaling pathway
    284 (ANGPT1)
   04151 PI3K-Akt signaling pathway
    284 (ANGPT1)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    284 (ANGPT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q23.1
AA seq 498 aa AA seqDB search
MTVFLSFAFLAAILTHIGCSNQRRSPENSGRRYNRIQHGQCAYTFILPEHDGNCRESTTD
QYNTNALQRDAPHVEPDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQNAV
QNHTATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQ
TNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRA
TTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIY
TIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNE
FIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLIL
HGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFK
GPSYSLRSTTMMIRPLDF
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacagttttcctttcctttgctttcctcgctgccattctgactcacatagggtgcagc
aatcagcgccgaagtccagaaaacagtgggagaagatataaccggattcaacatgggcaa
tgtgcctacactttcattcttccagaacacgatggcaactgtcgtgagagtacgacagac
cagtacaacacaaacgctctgcagagagatgctccacacgtggaaccggatttctcttcc
cagaaacttcaacatctggaacatgtgatggaaaattatactcagtggctgcaaaaactt
gagaattacattgtggaaaacatgaagtcggagatggcccagatacagcagaatgcagtt
cagaaccacacggctaccatgctggagataggaaccagcctcctctctcagactgcagag
cagaccagaaagctgacagatgttgagacccaggtactaaatcaaacttctcgacttgag
atacagctgctggagaattcattatccacctacaagctagagaagcaacttcttcaacag
acaaatgaaatcttgaagatccatgaaaaaaacagtttattagaacataaaatcttagaa
atggaaggaaaacacaaggaagagttggacaccttaaaggaagagaaagagaaccttcaa
ggcttggttactcgtcaaacatatataatccaggagctggaaaagcaattaaacagagct
accaccaacaacagtgtccttcagaagcagcaactggagctgatggacacagtccacaac
cttgtcaatctttgcactaaagaaggtgttttactaaagggaggaaaaagagaggaagag
aaaccatttagagactgtgcagatgtatatcaagctggttttaataaaagtggaatctac
actatttatattaataatatgccagaacccaaaaaggtgttttgcaatatggatgtcaat
gggggaggttggactgtaatacaacatcgtgaagatggaagtctagatttccaaagaggc
tggaaggaatataaaatgggttttggaaatccctccggtgaatattggctggggaatgag
tttatttttgccattaccagtcagaggcagtacatgctaagaattgagttaatggactgg
gaagggaaccgagcctattcacagtatgacagattccacataggaaatgaaaagcaaaac
tataggttgtatttaaaaggtcacactgggacagcaggaaaacagagcagcctgatctta
cacggtgctgatttcagcactaaagatgctgataatgacaactgtatgtgcaaatgtgcc
ctcatgttaacaggaggatggtggtttgatgcttgtggcccctccaatctaaatggaatg
ttctatactgcgggacaaaaccatggaaaactgaatgggataaagtggcactacttcaaa
gggcccagttactccttacgttccacaactatgatgattcgacctttagatttttga

DBGET integrated database retrieval system