KEGG   Homo sapiens (human): 284004Help
Entry
284004            CDS       T01001                                 

Gene name
HEXDC
Definition
hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing (EC:3.2.1.52)
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
hsa  Homo sapiens (human)
Pathway
Other glycan degradation
Class
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:hsa00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25.3
AA seq 585 aa AA seqDB search
MSGSTPFQMRLVHLDLKGAPPKVSYLSEIFPLFRALGANGLLIEYEDMFPYEGPLRLLRA
KYAYSPSEIKEILHLAGLNELEVIPLVQTFGHMEFVLKHTAFAHLREVGSFPCTLNPHEA
ESLALVGAMIDQVLELHPGAQRLHIGCDEVYYLGEGEASRRWLQQEQNSTGKLCLSHMRA
VASGVKARRPSVTPLVWDDMLRDLPEDQLAASGVPQLVEPVLWDYTADLDVHGKVLLMQK
YRRCGFPQLWAASAFKGATGPSQAVPPVEHHLRNHVQWLQVAGSGPTDSLQGIILTGWQR
YDHYSVLCELLPAGVPSLAACLQLLLRGGFDEDVKAKVENLLGISSLEKTDPVRQAPCSP
PCPLLPLPFPRPWRQLFSAGLSAGRGPAPSLAATSLPLSHKSASICAALWMRCWRATGMS
LAGSAPTTASGSSSTRSWFSTSSPQRSASWHSGAPSCRSWRLPCSWLSTRMPWRSGWRKT
CTPACSGCKLCCRTSARCLPPRCHPPALAGTLLRTPEGRAHARGLLLEAGGALHCQMAWA
IRAHVGVVPSGPAVSCPHSVPEGPGQPLGERLENTEGSSTGRPAL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggttccactccatttcagatgagattagttcatttagaccttaaaggagctcca
ccaaaggtctcgtacctctcagagatttttcctctgttccgtgcgctaggtgcaaacggc
ctcctcattgagtatgaagacatgtttccctacgagggccctctgaggctgctgagggcc
aagtacgcctacagcccctctgaaatcaaagagatcttgcatctggctggactcaatgag
ctggaggtgattcccttggtgcagacatttggacacatggagtttgtgctgaagcacacg
gccttcgcccacctgcgggaggtgggctccttcccctgcaccctgaacccccacgaggca
gagtccctggcgctggtgggcgccatgattgaccaggtcctggagctacacccaggcgcc
cagcggctgcacatcgggtgtgatgaggtctattacctcggagagggggaggcctcgcgc
cggtggctacagcaagagcagaacagcacggggaagttgtgcctgtcacacatgcgggcg
gtggccagcggcgtgaaggcccggcgccccagcgtgacacccctggtgtgggacgacatg
ctccgagacctgcctgaggaccagctcgcagcgtccggggtgccgcagctggtggagccg
gtgctctgggactacacggccgacctggatgtgcacggcaaggtcctcctcatgcagaag
taccggcggtgcggctttccgcagctgtgggcagccagtgccttcaagggtgccacgggg
cccagccaggccgtgccccctgttgagcaccacctcaggaaccacgtgcagtggctgcag
gtggcgggcagcgggcccacggactcactgcagggcatcatcctgaccggctggcagagg
tacgaccactactctgtgctgtgcgagctgctgcccgcaggagtcccgtccctggccgcc
tgcctgcagttgcttctacgcggaggatttgatgaagatgttaaagcgaaagtggagaac
cttctcgggatttccagcctggaaaaaacggaccctgttaggcaagcaccctgcagccct
ccctgtccccttcttcccctccccttcccccgcccgtggagacagctgttctcagcaggg
ctctccgcagggagggggccggctccttccctggcagcaacatccttgcccttgtcacac
aagtcagcctccatctgcgcagctctgtggatgcgctgctggagggcaacaggtatgtca
ctggctggttcagcccctaccaccgccagcggaagctcatccacccggtcatggttcagc
acatccagcccgcagcgctcagcctcctggcacagtggagcaccctcgtgcaggagctgg
aggctgccctgcagctggctttctacccggatgccgtggaggagtggctggaggaaaacg
tgcaccccagcctgcagcggctgcaagctctgctgcaggacctcagcgaggtgtctgccc
ccccgctgccacccaccagccctggcagggacgttgctcaggacccctgaggggagagct
catgccagggggctcctgctggaggctgggggggctctgcactgccaaatggcctgggca
atacgggcccacgtgggcgtcgtgccctctggcccagcagtgtcttgcccacactcagtt
cctgagggccctgggcagcccctgggggagagactagaaaacacagaaggaagcagcaca
gggagacccgctttgtga

DBGET integrated database retrieval system