KEGG   Homo sapiens (human): 284004Help
Entry
284004            CDS       T01001                                 

Gene name
HEXDC
Definition
hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing (EC:3.2.1.52)
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
hsa  Homo sapiens (human)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    284004 (HEXDC)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     284004 (HEXDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25.3
AA seq 585 aa AA seqDB search
MSGSTPFQMRLVHLDLKGAPPKVSYLSEIFPLFRALGANGLLIEYEDMFPYEGPLRLLRA
KYAYSPSEIKEILHLAGLNELEVIPLVQTFGHMEFVLKHTAFAHLREVGSFPCTLNPHEA
ESLALVGAMIDQVLELHPGAQRLHIGCDEVYYLGEGEASRRWLQQEQNSTGKLCLSHMRA
VASGVKARRPSVTPLVWDDMLRDLPEDQLAASGVPQLVEPVLWDYTADLDVHGKVLLMQK
YRRCGFPQLWAASAFKGATGPSQAVPPVEHHLRNHVQWLQVAGSGPTDSLQGIILTGWQR
YDHYSVLCELLPAGVPSLAACLQLLLRGGFDEDVKAKVENLLGISSLEKTDPVRQAPCSP
PCPLLPLPFPRPWRQLFSAGLSAGRGPAPSLAATSLPLSHKSASICAALWMRCWRATGMS
LAGSAPTTASGSSSTRSWFSTSSPQRSASWHSGAPSCRSWRLPCSWLSTRMPWRSGWRKT
CTPACSGCKLCCRTSARCLPPRCHPPALAGTLLRTPEGRAHARGLLLEAGGALHCQMAWA
IRAHVGVVPSGPAVSCPHSVPEGPGQPLGERLENTEGSSTGRPAL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggttccactccatttcagatgagattagttcatttagaccttaaaggagctcca
ccaaaggtctcgtacctctcagagatttttcctctgttccgtgcgctaggtgcaaacggc
ctcctcattgagtatgaagacatgtttccctacgagggccctctgaggctgctgagggcc
aagtacgcctacagcccctctgaaatcaaagagatcttgcatctggctggactcaatgag
ctggaggtgattcccttggtgcagacatttggacacatggagtttgtgctgaagcacacg
gccttcgcccacctgcgggaggtgggctccttcccctgcaccctgaacccccacgaggca
gagtccctggcgctggtgggcgccatgattgaccaggtcctggagctacacccaggcgcc
cagcggctgcacatcgggtgtgatgaggtctattacctcggagagggggaggcctcgcgc
cggtggctacagcaagagcagaacagcacggggaagttgtgcctgtcacacatgcgggcg
gtggccagcggcgtgaaggcccggcgccccagcgtgacacccctggtgtgggacgacatg
ctccgagacctgcctgaggaccagctcgcagcgtccggggtgccgcagctggtggagccg
gtgctctgggactacacggccgacctggatgtgcacggcaaggtcctcctcatgcagaag
taccggcggtgcggctttccgcagctgtgggcagccagtgccttcaagggtgccacgggg
cccagccaggccgtgccccctgttgagcaccacctcaggaaccacgtgcagtggctgcag
gtggcgggcagcgggcccacggactcactgcagggcatcatcctgaccggctggcagagg
tacgaccactactctgtgctgtgcgagctgctgcccgcaggagtcccgtccctggccgcc
tgcctgcagttgcttctacgcggaggatttgatgaagatgttaaagcgaaagtggagaac
cttctcgggatttccagcctggaaaaaacggaccctgttaggcaagcaccctgcagccct
ccctgtccccttcttcccctccccttcccccgcccgtggagacagctgttctcagcaggg
ctctccgcagggagggggccggctccttccctggcagcaacatccttgcccttgtcacac
aagtcagcctccatctgcgcagctctgtggatgcgctgctggagggcaacaggtatgtca
ctggctggttcagcccctaccaccgccagcggaagctcatccacccggtcatggttcagc
acatccagcccgcagcgctcagcctcctggcacagtggagcaccctcgtgcaggagctgg
aggctgccctgcagctggctttctacccggatgccgtggaggagtggctggaggaaaacg
tgcaccccagcctgcagcggctgcaagctctgctgcaggacctcagcgaggtgtctgccc
ccccgctgccacccaccagccctggcagggacgttgctcaggacccctgaggggagagct
catgccagggggctcctgctggaggctgggggggctctgcactgccaaatggcctgggca
atacgggcccacgtgggcgtcgtgccctctggcccagcagtgtcttgcccacactcagtt
cctgagggccctgggcagcccctgggggagagactagaaaacacagaaggaagcagcaca
gggagacccgctttgtga

DBGET integrated database retrieval system