KEGG   Homo sapiens (human): 284058Help
Entry
284058            CDS       T01001                                 

Gene name
KANSL1, CENP-36, KDVS, KIAA1267, MSL1v1, NSL1, hMSL1v1
Definition
KAT8 regulatory NSL complex subunit 1
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21.31
AA seq 1104 aa AA seqDB search
MAAMAPALTDAAAEAHHIRFKLAPPSSTLSPGSAENNGNANILIAANGTKRKAIAAEDPS
LDFRNNPTKEDLGKLQPLVASYLCSDVTSVPSKESLKLQGVFSKQTVLKSHPLLSQSYEL
RAELLGRQPVLEFSLENLRTMNTSGQTALPQAPVNGLAKKLTKSSTHSDHDNSTSLNGGK
RALTSSALHGGEMGGSESGDLKGGMTNCTLPHRSLDVEHTTLYSNNSTANKSSVNSMEQP
ALQGSSRLSPGTDSSSNLGGVKLEGKKSPLSSILFSALDSDTRITALLRRQADIESRARR
LQKRLQVVQAKQVERHIQHQLGGFLEKTLSKLPNLESLRPRSQLMLTRKAEAALRKAASE
TTTSEGLSNFLKSNSISEELERFTASGIANLRCSEQAFDSDVTDSSSGGESDIEEEELTR
ADPEQRHVPLRRRSEWKWAADRAAIVSRWNWLQAHVSDLEYRIRQQTDIYKQIRANKGLI
VLGEVPPPEHTTDLFLPLSSEVKTDHGTDKLIESVSQPLENHGAPIIGHISESLSTKSCG
ALRPVNGVINTLQPVLADHIPGDSSDAEEQLHKKQRLNLVSSSSDGTCVAARTRPVLSCK
KRRLVRPNSIVPLSKKVHRNSTIRPGCDVNPSCALCGSGSINTMPPEIHYEAPLLERLSQ
LDSCVHPVLAFPDDVPTSLHFQSMLKSQWQNKPFDKIKPPKKLSLKHRAPMPGSLPDSAR
KDRHKLVSSFLTTAKLSHHQTRPDRTHRQHLDDVGAVPMVERVTAPKAERLLNPPPPVHD
PNHSKMRLRDHSSERSEVLKHHTDMSSSSYLAATHHPPHSPLVRQLSTSSDSPAPASSSS
QVTASTSQPVRRRRGESSFDINNIVIPMSVAATTRVEKLQYKEILTPSWREVDLQSLKGS
PDEENEEIEDLSDAAFAALHAKCEEMERARWLWTTSVPPQRRGSRSYRSSDGRTTPQLGS
ANPSTPQPASPDVSSSHSLSEYSHGQSPRSPISPELHSAPLTPVARDTPRHLASEDTRCS
TPELGLDEQSVQPWERRTFPLAHSPQAECEDQLDAQERAARCTRRTSGSKTGRETEAAPT
SPPIVPLKSRHLVAAATAQRPTHR
NT seq 3315 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgatggcgcccgctctcactgacgcagcagctgaagcacaccatatccggttc
aaactggctcccccatcctctaccttgtcccctggcagtgccgaaaataacggcaacgcc
aacatccttattgctgccaacggaaccaaaagaaaagccattgctgcagaggatcccagc
ctagatttccgaaataatcctaccaaggaagacttgggaaagctgcaaccactggtggca
tcttatctctgctctgatgtaacatctgttccctcaaaggagtctttgaagttgcaaggg
gtcttcagcaagcagacagtccttaaatctcatcctctcttatctcagtcctatgaactc
cgagctgagctgttggggagacagccagttttggagttttccttagaaaatcttagaacc
atgaatacgagtggtcagacagctctgccacaagcacctgtaaatgggttggctaagaaa
ttgactaaaagttcaacacattctgatcatgacaattccacttccctcaatgggggaaaa
cgggctctcacttcatctgctcttcatgggggtgaaatgggaggatctgaatctggggac
ttgaaggggggtatgaccaattgcactcttccacatagaagccttgatgtagaacacaca
actttgtatagcaataatagcactgcaaacaaatcctctgtcaattccatggaacagccg
gcacttcaaggaagcagtagattatcacctggtacagactccagctctaacttggggggt
gtcaaattggagggtaaaaagtctcccctgtcttccattcttttcagtgctttagattct
gacacaaggataacagctttactgcggcgacaggctgacattgagagccgtgcccgcaga
ttacaaaagcgcttacaggttgtgcaagccaagcaggttgagaggcatatacaacatcag
ctgggtggatttttggagaagactttgagcaaactgccaaacttggaatccttgagacca
cggagccagttgatgctgactcgaaaggctgaagctgccttgagaaaagctgccagtgag
accaccacttcagagggacttagcaactttctgaaaagcaattcaatttcagaagaattg
gagagatttacagctagtggcatagccaacttgaggtgcagtgaacaggcatttgattca
gatgtcactgacagtagttcaggaggggagtctgatattgaagaggaagaactgaccaga
gctgatcccgagcagcgtcatgtacccctgagacgcaggtcagaatggaaatgggctgca
gaccgggcagctattgtcagccgctggaactggcttcaggctcatgtttctgacttggaa
tatcgaattcgtcagcaaacagacatttacaaacagatacgtgctaataaggggttgata
gttcttggggaggtacctcccccagagcatacaacagacttatttcttccacttagttct
gaggtgaagacagatcatgggactgataaattgattgagtctgtttctcagccattggaa
aaccatggtgcccctattattggtcatatttcagagtcactgtctaccaaatcatgtgga
gcactcagacctgtcaatggagttattaacactcttcagcctgtcttggcagaccacatt
ccaggtgacagctctgatgctgaggaacaattacataagaagcaacgactgaatctcgtc
tcttcatcatctgatggcacctgtgtggcagcccggacacgtcctgtactgagctgtaag
aagcggaggcttgttcgacccaacagcatcgttcctctttccaagaaggttcaccggaac
agcacaatccgccctggctgtgatgtgaatccctcctgcgcactgtgtggttcaggcagc
atcaacaccatgcctcccgaaattcactatgaagcccctctgttggaacgtctttcccag
ttggactcttgtgttcatcctgttctagcatttccagatgatgttcccacaagcctgcat
ttccagagcatgctgaaatctcagtggcagaacaagccttttgacaaaatcaaacctccc
aaaaagttatcgcttaagcacagagcacccatgccgggcagtctgccagattcagctcgt
aaggacaggcacaaattggtcagctccttcctaacaacagccaagctgtcccatcaccaa
acccggcctgacaggacccacaggcagcacttagacgatgtgggggccgtgcccatggtg
gagcgagtgacagcgccaaaagcagagcgcttgctcaacccaccaccacccgtgcatgac
ccaaaccacagcaaaatgagattgcgagaccattcatctgagagaagtgaagtgttgaag
catcacacagacatgagcagttcgagctacttggcagccacccaccatcctccacacagt
cccttggtgcgacagctctccacctcctcagattcccctgcacccgccagctctagctca
caggttacagccagcacatcgcagccagtaaggaggagaaggggagagagctcatttgat
attaacaacattgtcatcccaatgtctgttgctgcaacaactcgcgtagagaaactgcaa
tacaaggaaatccttacgcccagctggcgggaggttgatcttcagtctctgaaggggagt
cctgatgaggagaatgaagagattgaggacctatccgacgcagccttcgccgccctgcat
gccaaatgtgaggagatggagagggcacggtggctgtggaccacgagtgtgccaccccag
cggcggggcagcaggtcctacaggtcatcagacggccggacaaccccccagctgggcagt
gccaacccctccaccccccagcctgcctcccctgatgtcagcagtagccactctttgtca
gaatactcccatggtcagtcccctaggagccccattagcccggaactgcactcagcaccc
ctcacccctgtggctcgggacactccgcgacacttagccagtgaggatacccgttgttcc
acaccagagctggggctggatgaacagtctgtccagccctgggagcggcggaccttcccc
ctggcgcacagtccccaggcggagtgtgaggaccagctggatgcacaggagcgagcagcc
cgctgcactcgacgcacctcaggcagcaagactggccgggagacagaggcagcgcccacc
tcgcctcccattgtccccctcaagagtcggcatctggtggcagcagccacagctcagcgc
ccgactcacagatga

DBGET integrated database retrieval system