KEGG   Homo sapiens (human): 284521Help
Entry
284521            CDS       T01001                                 

Gene name
OR2L13, OR2L14
Definition
olfactory receptor, family 2, subfamily L, member 13
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    284521 (OR2L13)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    284521 (OR2L13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
1q44
AA seq 312 aa AA seqDB search
MEKWNHTSNDFILLGLLPPNQTGIFLLCLIILIFFLASVGNSAMIHLIHVDPRLHTPMYF
LLSQLSLMDLMYISTTVPKMAYNFLSGQKGISFLGCGVQSFFFLTMACSEGLLLTSMAYD
RYLAICHSLYYPIRMSKMMCVKMIGGSWTLGSINSLAHTVFALHIPYCRSRAIDHFFCDV
PAMLLLACTDTWVYEYMVFVSTSLFLLFPFIGITSSCGRVLFAVYHMHSKEGRKKAFTTI
STHLTVVIFYYAPFVYTYLRPRNLRSPAEDKILAVFYTILTPMLNPIIYSLRNKEVLGAM
RRVFGIFSFLKE
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggagaaatggaatcacacttcaaatgatttcattttgttgggtctgcttcccccaaat
caaactggaatatttctcttgtgccttatcatcctcatattctttctggcctcggtgggt
aactcggccatgattcacctcatccacgtggatcctcgtctccacacaccgatgtacttt
cttctcagccagctctcccttatggacctgatgtacatctccaccaccgtccccaagatg
gcgtacaacttcctgtccggccagaaaggcatctccttcctgggatgtggtgtgcaaagc
ttcttcttcctgaccatggcgtgttctgaaggcttactcctgacctccatggcctacgac
cgttatttggccatctgccactctctctattatcctatccgcatgagtaaaatgatgtgt
gtgaagatgattggaggctcttggacactggggtccatcaactccttggcacacacagtc
tttgcccttcatattccctactgcaggtctagggctattgaccatttcttctgcgatgtc
ccagccatgttgcttcttgcctgtacagatacttgggtctatgaatatatggtttttgta
agtacaagcctctttctccttttccctttcattggcatcacttcttcctgtggccgagtc
ctatttgctgtctatcatatgcactcaaaggaggggagaaaaaaggccttcaccaccatt
tcaacacatttaactgtagtgatcttttactatgcaccttttgtctacacctatcttcgg
cccaggaatctccgctcaccagctgaagacaagatcctggcagtcttctacaccatcctt
acccccatgctcaatcccattatctacagcctgaggaataaggaagtcctgggggctatg
aggagagtgtttgggatattctctttcctgaaagaataa

DBGET integrated database retrieval system