KEGG   Homo sapiens (human): 284521Help
Entry
284521            CDS       T01001                                 

Gene name
OR2L13, OR2L14
Definition
(RefSeq) olfactory receptor family 2 subfamily L member 13
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    284521 (OR2L13)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    284521 (OR2L13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx BofA
Motif
Other DBs
NCBI-GeneID: 284521
NCBI-ProteinID: NP_001291464
HGNC: 19578
Ensembl: ENSG00000196071
Vega: OTTHUMG00000040446
Pharos: Q8N349(Tdark)
UniProt: Q8N349 A0A126GW96
Position
1q44
AA seq 312 aa AA seqDB search
MEKWNHTSNDFILLGLLPPNQTGIFLLCLIILIFFLASVGNSAMIHLIHVDPRLHTPMYF
LLSQLSLMDLMYISTTVPKMAYNFLSGQKGISFLGCGVQSFFFLTMACSEGLLLTSMAYD
RYLAICHSLYYPIRMSKMMCVKMIGGSWTLGSINSLAHTVFALHIPYCRSRAIDHFFCDV
PAMLLLACTDTWVYEYMVFVSTSLFLLFPFIGITSSCGRVLFAVYHMHSKEGRKKAFTTI
STHLTVVIFYYAPFVYTYLRPRNLRSPAEDKILAVFYTILTPMLNPIIYSLRNKEVLGAM
RRVFGIFSFLKE
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggagaaatggaatcacacttcaaatgatttcattttgttgggtctgcttcccccaaat
caaactggaatatttctcttgtgccttatcatcctcatattctttctggcctcggtgggt
aactcggccatgattcacctcatccacgtggatcctcgtctccacacaccgatgtacttt
cttctcagccagctctcccttatggacctgatgtacatctccaccaccgtccccaagatg
gcgtacaacttcctgtccggccagaaaggcatctccttcctgggatgtggtgtgcaaagc
ttcttcttcctgaccatggcgtgttctgaaggcttactcctgacctccatggcctacgac
cgttatttggccatctgccactctctctattatcctatccgcatgagtaaaatgatgtgt
gtgaagatgattggaggctcttggacactggggtccatcaactccttggcacacacagtc
tttgcccttcatattccctactgcaggtctagggctattgaccatttcttctgcgatgtc
ccagccatgttgcttcttgcctgtacagatacttgggtctatgaatatatggtttttgta
agtacaagcctctttctccttttccctttcattggcatcacttcttcctgtggccgagtc
ctatttgctgtctatcatatgcactcaaaggaggggagaaaaaaggccttcaccaccatt
tcaacacatttaactgtagtgatcttttactatgcaccttttgtctacacctatcttcgg
cccaggaatctccgctcaccagctgaagacaagatcctggcagtcttctacaccatcctt
acccccatgctcaatcccattatctacagcctgaggaataaggaagtcctgggggctatg
aggagagtgtttgggatattctctttcctgaaagaataa

DBGET integrated database retrieval system